KEGG   Bacillus thuringiensis HD1011: BF38_2599Help
Entry
BF38_2599         CDS       T03675                                 

Definition
(GenBank) phosphotransferase enzyme family protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
btw  Bacillus thuringiensis HD1011
Brite
KEGG Orthology (KO) [BR:btw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:btw01504]
    BF38_2599
Enzymes [BR:btw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BF38_2599
Antimicrobial resistance genes [BR:btw01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BF38_2599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Pkinase
Motif
Other DBs
NCBI-ProteinID: AJG74914
UniProt: A0A0B5NAX6
Position
complement(2500215..2501117)
Genome map
AA seq 300 aa AA seqDB search
MDSYKQYIKEALPNLSIHSYKQNEEGWDNVAVIVNDELLFRFPRKQEYAMRIPLEKELCT
ILTQSLQEIEVPQYHLIYKNESDEVPLCSYYTLIHGEPLKTEIVANLDEKERKIIITQLA
TFLAALHSIPLKSVTALGFPTEKTLTYWKELQTKLNEYVTNSLTSFQKSTLNRLFENFFA
CIATSAFPNAIIHADFTHHHILFDKQNKIISGIIDFGDAQIGDPAFDFAGLYYDFGHEFT
TSVYEQYSTLTSHHDPLLIHRITSFYQYSPLLHNMIYNFETKNELEFLASIEQLKVILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacaatatataaaagaagctttgcctaatctttctatacactcatat
aaacaaaatgaagaaggatgggataatgtagcggttattgtaaatgatgaactattgttt
cgtttcccgcgaaaacaggaatatgcaatgcgaattccgttagaaaaagaactgtgcaca
attctcactcaatcactacaagaaatcgaagttccacaatatcacctaatttataaaaat
gaatctgatgaagttcctctttgtagttactatactctcattcatggtgaaccattaaaa
acagaaatagttgcgaacttagatgaaaaagaacgaaaaataattattacacaattagct
actttccttgcggctctacatagcattcctctaaaaagtgttacagcgttagggttccct
accgaaaaaacacttacctactggaaagagctacaaactaaattaaatgagtatgttact
aacagtctaacttcgttccagaaatcaaccttaaaccgtttattcgagaatttttttgcc
tgtatagctacatcggcatttccaaatgcaatcattcacgctgactttacacatcatcat
attttatttgataaacaaaataaaatcatttcagggattatcgattttggtgatgctcaa
attggagatcctgcctttgattttgctgggctatattatgatttcggacatgaatttact
acatcagtatatgaacaatatagtacacttacttcacaccatgacccattactcattcac
cgcatcacgagtttttatcagtacagtcctttactacataacatgatttataactttgaa
acaaagaatgaacttgaatttctagcaagtatagaacaactgaaagtaatactgcaggga
tga

DBGET integrated database retrieval system