KEGG   Bacillus thuringiensis HD1011: BF38_5195Help
Entry
BF38_5195         CDS       T03675                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00071  Fatty acid degradation
btw00072  Synthesis and degradation of ketone bodies
btw00280  Valine, leucine and isoleucine degradation
btw00310  Lysine degradation
btw00362  Benzoate degradation
btw00380  Tryptophan metabolism
btw00620  Pyruvate metabolism
btw00630  Glyoxylate and dicarboxylate metabolism
btw00640  Propanoate metabolism
btw00650  Butanoate metabolism
btw00900  Terpenoid backbone biosynthesis
btw01100  Metabolic pathways
btw01110  Biosynthesis of secondary metabolites
btw01120  Microbial metabolism in diverse environments
btw01130  Biosynthesis of antibiotics
btw01200  Carbon metabolism
btw01212  Fatty acid metabolism
btw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF38_5195 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    BF38_5195 (thlA)
   00640 Propanoate metabolism
    BF38_5195 (thlA)
   00650 Butanoate metabolism
    BF38_5195 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BF38_5195 (thlA)
   00072 Synthesis and degradation of ketone bodies
    BF38_5195 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BF38_5195 (thlA)
   00310 Lysine degradation
    BF38_5195 (thlA)
   00380 Tryptophan metabolism
    BF38_5195 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BF38_5195 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BF38_5195 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BF38_5195 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btw04147]
    BF38_5195 (thlA)
Enzymes [BR:btw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BF38_5195 (thlA)
Exosome [BR:btw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF38_5195 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJG78832
UniProt: A0A0B5NZD3
Position
complement(5052841..5054016)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccgaaaattatgggtattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaacggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattacggtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggt
ggtattggggtagcattatttatagaagcattataa

DBGET integrated database retrieval system