KEGG   Bartonella tribocorum BM1374166: BM1374166_00101Help
Entry
BM1374166_00101   CDS       T03233                                 

Gene name
argF_1
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
btx  Bartonella tribocorum BM1374166
Pathway
btx00220  Arginine biosynthesis
btx01100  Metabolic pathways
btx01110  Biosynthesis of secondary metabolites
btx01130  Biosynthesis of antibiotics
btx01230  Biosynthesis of amino acids
Module
btx_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:btx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BM1374166_00101 (argF_1)
Enzymes [BR:btx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BM1374166_00101 (argF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CDO47797
Position
145683..146099
Genome map
AA seq 138 aa AA seqDB search
MQLGYSETIADTARVLSRFVDIVILRTTKHQRMLELAQYAQIPVINALTDDTHPCQILAD
ILTYEEHRGPITGKILAWLGDGNNVLHSLIEAAALFGFHLHVATPKGSEPQEQFLHWARE
RGAYLTLTHKSSKSSSRC
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggttatagtgaaaccatagctgatacggcacgcgttttatcccgctttgta
gatatcgtgatattgcggacaacaaaacatcaacgtatgcttgaattagcacaatatgca
caaattcctgtcattaatgcccttacagatgatacacatccttgccaaattctagcagat
atcttaacctatgaggaacatcgagggcccattactggcaaaatattggcatggctgggg
gatggtaataacgtgctccattctttaattgaagctgcagctctttttggttttcatttg
catgttgctactccaaaaggtagtgaaccgcaagagcagtttctacattgggcacgtgag
cggggagcatatcttacgctaacccataaatcctcaaaaagcagctcaagatgctga

DBGET integrated database retrieval system