KEGG   Bartonella tribocorum BM1374166: BM1374166_00861Help
Entry
BM1374166_00861   CDS       T03233                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
btx  Bartonella tribocorum BM1374166
Pathway
btx00540  Lipopolysaccharide biosynthesis
btx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BM1374166_00861 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:btx01003]
    BM1374166_00861 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:btx01005]
    BM1374166_00861 (lpxB)
Enzymes [BR:btx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     BM1374166_00861 (lpxB)
Glycosyltransferases [BR:btx01003]
 Polysaccharide
  Bacterial polysaccharide
   BM1374166_00861 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:btx01005]
 Lipid A
  BM1374166_00861 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-ProteinID: CDO48545
Position
988372..989568
Genome map
AA seq 398 aa AA seqDB search
MNNSLLKIAVIAGEESGDFLGADLISCLSQQIGCNIHLIGVGGRHLEALGLKSFFDSHDI
GLIGLKEVLKKLPLLLLHIRNLSKFIAQEQPDCLIIIDSPDFTHRVAKKVRALAPSIPII
KYIAPTVWAWRPERAKAMREFVDHVLAVFPFEEKVMQDLGGPATTYVGHRLSTYPPLLKV
QSEKRRQVEQRHLYDQQILSPTLVILPGSRNSEILSLMPIFRETVEILVQRIPHLQIILP
TLPHLVDRIHDFIQDWKSKVEIVVGEDKKWRAFAQADVALASHGTVSLELALVKVPTVLC
YKLDRFAKLFIFPKITLWSAALPNIIADKPIVPEYLNEFIRPGMLARQIEQLLSNPLLRQ
AQLDAFEVVEQKMKTEIPSGIIGAQKIITLLKSRGIII
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagtttattaaagattgctgtgattgcgggtgaggaatctggtgattttctt
ggggctgatttaatttcttgtttatcacaacaaataggatgcaatattcatttgataggg
gttggggggaggcatttagaggctttaggtttaaaaagcttttttgattcccatgatatt
ggtttaataggtttaaaggaggtgttgaaaaaattaccgttgttgttgctccatattcgc
aatttatccaaatttatcgcacaagaacaacctgattgtttaattattattgatagtcct
gattttacgcatcgtgttgcaaaaaaggtacgtgctttagcgccttctattccgatcatt
aaatatatcgcaccaactgtttgggcatggaggccagagcgtgcaaaagctatgcgggaa
tttgttgatcatgttttagcggtttttccttttgaagaaaaggttatgcaggatttgggt
ggtcctgctaccacctatgttggacatcgtctttcgacgtatcctcctcttttgaaagtt
cagtcagaaaaaaggcgccaagtagaacaaagacatttgtatgatcaacaaatattatcg
cctacattggttattttgccaggatcacgcaattcagagattctttctttaatgcctatt
tttcgagaaacggtagagattcttgtacaacgtattcctcatttacagattattttaccc
actttaccccatttggtggatagaatccatgactttattcaggactggaaaagcaaagta
gaaattgttgttggtgaagataaaaaatggcgtgcttttgcacaagcagatgttgctctt
gcttcccatggaacggtttcacttgagttagctttagtaaaagttcctacggttctttgc
tataaacttgatcgttttgctaaattatttatttttcctaaaataacgttatggagtgct
gctcttccgaatattattgctgataagcctattgttccagaatatttgaatgaatttata
cgtcctggcatgttagcaagacagatagaacaacttttatctaatcctttattgcgccaa
gctcaactcgatgcttttgaggtggtcgaacagaaaatgaaaactgaaatcccatcggga
attataggtgcgcaaaaaattatcactcttttaaaaagtaggggcataattatataa

DBGET integrated database retrieval system