KEGG   Bacillus toyonensis: Btoyo_0254Help
Entry
Btoyo_0254        CDS       T02901                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
bty  Bacillus toyonensis
Pathway
bty00020  Citrate cycle (TCA cycle)
bty00620  Pyruvate metabolism
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
bty01120  Microbial metabolism in diverse environments
bty01130  Biosynthesis of antibiotics
bty01200  Carbon metabolism
Module
bty_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bty_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Btoyo_0254
   00620 Pyruvate metabolism
    Btoyo_0254
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Btoyo_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase HI0933_like FAD_binding_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AHA06262
Position
238309..239811
Genome map
AA seq 500 aa AA seqDB search
MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGTGHS
ALCELNYTSEKSDGSIDISKAVKVNEQFQLSRQFWAYLVKSKLIRNPQDFIMPLPHMSLV
EGEKNVEFLKNRFEALSKNPLFQGMEFSDAPETLKKWLPLIMEGRTSNEPMAATKIDSGT
DVNFGALTRMLFDYLQTKNVELNYKHSVENIKRTKNGLWEVKVHDMNSGKIEHHTAKFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFMVCKNQKVIEQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNKKALLFGPFAGFSPKFLKTGSNLDLIGSVKPNNVLTMLAAGVKEMGLTKY
LIQQVMLSHEKRMEELREFIPNAKSEDWDIVVAGQRVQVIKDTDAGGKGTLQFGTEVVSA
ADGSIAALLGASPGASTAVHVMLEVLEKCFPDRILGWEEKIKEMIPSYGISLTENPRLFQ
DLHTSTGRTLGLNEKETVHN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatgcagcaaaaaacagacgttatcttaattggtgcaggaattatgagtgca
acgttaggctcattactaaaagaattagcacctgaatgggaaattaaagtttttgaaaaa
ctcgcaagtgccggggaagaaagctctaacgaatggaataatgcaggtacagggcattct
gcgctatgcgaactgaactatacttccgaaaaatctgacggatctatagatattagtaag
gctgtaaaagtgaatgagcaattccagctttcaagacaattttgggcatatcttgtaaaa
agcaaattaattcgtaatccacaagattttattatgccacttcctcatatgagtttagta
gaaggggaaaaaaatgtagagtttctaaaaaatcgttttgaagcgctttcaaaaaatcca
ctgtttcaaggaatggagttttctgatgctcctgaaacattaaaaaaatggcttcctctc
attatggaaggtcgtacatctaatgaaccgatggctgcaacgaagattgactctggaaca
gatgttaacttcggtgcattaacacgtatgttgtttgattacttacaaacgaaaaatgtc
gagctaaactacaaacatagtgtcgaaaatattaaacgcacgaaaaatggtttgtgggaa
gtaaaagtacacgatatgaatagtggtaaaattgagcatcatactgcaaaatttgtcttt
atcggtggcggtggcggtagcctacctctactacaaaagacaggtattcctgaatcaaaa
catatcggtggattcccagtaagtggactatttatggtatgtaaaaatcaaaaagtcatt
gagcaacatcatgcaaaagtatacggtaaagctaaagttggtgctccgccaatgtctgta
cctcatctggatacgagatatatagataataaaaaagctttattgttcggaccgttcgca
gggttctcacctaaattcttaaaaactggttcaaatcttgacttaatcggttctgtaaaa
ccgaataacgtcttaacgatgttagctgctggtgtaaaagaaatgggactaacaaaatac
ttaattcaacaagttatgttatcacatgaaaaacgtatggaagaattacgcgaattcatt
ccgaacgcaaaaagtgaagattgggatattgtagttgctgggcaacgtgtacaagtaatt
aaagatactgatgctggcggtaaaggcacacttcaattcggtacagaagttgtaagtgca
gctgacggatcaatcgctgcattactaggtgcttcaccaggtgcttctactgccgttcac
gtcatgcttgaagtattagaaaaatgtttccctgatcgtatattaggatgggaagaaaaa
ataaaagaaatgattccttcttatggcatttctcttactgaaaatccaagactattccaa
gatttacacacttcaactggacgtacacttggattaaacgaaaaagaaactgttcataat
taa

DBGET integrated database retrieval system