KEGG   Bacillus toyonensis: Btoyo_1215Help
Entry
Btoyo_1215        CDS       T02901                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bty  Bacillus toyonensis
Pathway
bty00010  Glycolysis / Gluconeogenesis
bty00020  Citrate cycle (TCA cycle)
bty00620  Pyruvate metabolism
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
bty01120  Microbial metabolism in diverse environments
bty01130  Biosynthesis of antibiotics
bty01200  Carbon metabolism
Module
bty_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btoyo_1215
   00020 Citrate cycle (TCA cycle)
    Btoyo_1215
   00620 Pyruvate metabolism
    Btoyo_1215
Enzymes [BR:bty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Btoyo_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: AHA07222
Position
complement(1213273..1214562)
Genome map
AA seq 429 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAIVGDTLIKFDAPGYENLKFKGDDHDEAPKAEEAAVEAPAAEATPAATAEVVNE
RVIAMPSVRKYAREKGVDIHKVAGSGKNGRVVKADIDAFANGGQTVAATEAPAAVEATPA
AAKEEAPKAQPIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHR
KKFKAVAADKGIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTD
KGLLVPVVKDTDRKSIFTISNEINDLAGKAREGRLAPTEMKGASCTITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLN
DPQLLVMEA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgatgaagtaaatgaagacgatgtacttcttgaagtacaa
aatgataaagcagtagtagaaatcccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggaacagttgcaattgtaggagatacattaattaaatttgatgctcctgga
tacgaaaaccttaaatttaaaggtgacgatcatgatgaagctccaaaagctgaagaagca
gcagtagaagctccagcagcggaagctactccagcagcaactgcagaagtagtaaatgag
cgcgttatcgctatgccatctgttcgtaaatatgctcgtgaaaaaggtgtagatattcat
aaagtagctggatctggtaagaacggtcgcgttgtgaaagctgacatcgatgcatttgca
aatggtggacaaactgtagcagcaactgaggctccagcagcagtagaagctactccagca
gcagcgaaagaagaagcaccaaaagcacaaccaatcccagctggtgaatatccagaaact
cgtgagaaaatgagtggtatccgtaaagcgattgcgaaagcaatggttaactctaagcat
acagctcctcacgtaacattaatggatgaagttgatgtaactgagcttgttgctcaccgt
aagaagttcaaagctgttgcagctgacaaaggtattaaattaacttaccttccgtacgtt
gttaaagctttaacatctgcattacgtgaatacccaatgttaaacacttctttagacgat
gcatctcaagaagtagttcacaaacattacttcaacatcggtatcgcagctgatacagac
aaaggtctattagtaccagttgttaaagatacagatcgcaagtctatcttcactatttct
aacgagatcaatgatcttgctggtaaagcacgtgaaggtcgtttagctccaactgaaatg
aaaggtgcttcttgcacaattacaaacattggttctgcaggtggacaatggttcactcca
gttatcaatcacccagaagtagcaatccttggtatcggccgtatcgctgagaagccagtt
gtgaaaaatggtgagatcgttgcagctccagtattagcattatctctaagctttgaccat
cgtttaattgacggcgcaactgctcaaaaagcattaaaccaaattaaacgtctattgaat
gacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system