KEGG   Bacillus toyonensis: Btoyo_1267Help
Entry
Btoyo_1267        CDS       T02901                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bty  Bacillus toyonensis
Pathway
bty00071  Fatty acid degradation
bty00072  Synthesis and degradation of ketone bodies
bty00280  Valine, leucine and isoleucine degradation
bty00310  Lysine degradation
bty00362  Benzoate degradation
bty00380  Tryptophan metabolism
bty00620  Pyruvate metabolism
bty00630  Glyoxylate and dicarboxylate metabolism
bty00640  Propanoate metabolism
bty00650  Butanoate metabolism
bty00900  Terpenoid backbone biosynthesis
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
bty01120  Microbial metabolism in diverse environments
bty01130  Biosynthesis of antibiotics
bty01200  Carbon metabolism
bty01212  Fatty acid metabolism
bty02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Btoyo_1267
   00630 Glyoxylate and dicarboxylate metabolism
    Btoyo_1267
   00640 Propanoate metabolism
    Btoyo_1267
   00650 Butanoate metabolism
    Btoyo_1267
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Btoyo_1267
   00072 Synthesis and degradation of ketone bodies
    Btoyo_1267
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Btoyo_1267
   00310 Lysine degradation
    Btoyo_1267
   00380 Tryptophan metabolism
    Btoyo_1267
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Btoyo_1267
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Btoyo_1267
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Btoyo_1267
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bty04147]
    Btoyo_1267
Enzymes [BR:bty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Btoyo_1267
Exosome [BR:bty04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Btoyo_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHA07274
Position
complement(1265949..1267124)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNITPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVIAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALQAIESGYFDDQIVPITIKERRKEIVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgtcattacagctgcagttcgttcaccaattggaactttcggaggagca
ctaaaaaatataacaccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaattcaattaggtgtgagtgatgttgttattgcaggtggagtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagtgctagaagatccgattcatcatattatgatgggtgaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactacaagcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagagcgtagaaaagaaattgtattttctaaggatgaacatccgcgtgca
gatattacagcggaaaaattagctggattaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggtcttaatgacggaagtgcagttctagtattaatgagtgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggctattcagtagct
ggagtagatcctaaaattatgggaattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttacttgaaattaatgaagctttcgctgcg
caatacctagctgtagagaaagaattaggtttagaccgtgaaaaagtgaatgtaaacggt
agtggtgtaggacttggacacccaatcggttgtacaggagctcgtatcactgtaagttta
attcatgaattaaaaagacgtggattagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggttgccttatttatagaagcgttataa

DBGET integrated database retrieval system