KEGG   Bacillus toyonensis: Btoyo_3348Help
Entry
Btoyo_3348        CDS       T02901                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bty  Bacillus toyonensis
Pathway
bty00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Btoyo_3348
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Btoyo_3348
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Btoyo_3348
    1.1.1.-  
     Btoyo_3348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C Gp_dh_N OxoDH_E1alpha_N
Motif
Other DBs
NCBI-ProteinID: AHA09243
Position
3300611..3301663
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVRPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGDGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVIGILGYRHI
FPSVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtacgagtagaagaagtaccagaacca
actgtacgaccaggagcagtaaaaattaaagttaaatggtgtggtatttgcgggacagac
ttgcatgaatatttagcagggccaatttttattccgacagaagagcacccattaacacat
gtgaaagcacctgttattttaggtcatgaatttagtggtgaggtagttgaaattggtgaa
ggtgttacatctcataaagtgggagaccgcgttgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacagcttgttttccacggt
cttggtggagacggcggtggcttctctgaatatacagtagtaccagaagatatggttcat
catattccagatgaaatgacgtatgaacaaggtgcacttgtagaaccagcagcagtagca
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagcagtatttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatc
gcagttgaactttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttaaatccagcaactcaagatgtattagcagaaattcgtaacttaacaaacggtttaggt
gtaaatgttagcttcgaagtaacaggtgttgaagttgtactacgtcaagcaattgaaagt
acaagtttcgaaggacaaacggtaattgttagcgtatgggaaaaagatgcaacaattact
ccgaacaaccttgtattaaaagaaaaagaagttatcggtattcttggataccgtcacatc
ttcccatctgttattaaattaattagctctggtcaaattcaagcagagaaattaattacg
aaaaaaattacagtggatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacccaaataa

DBGET integrated database retrieval system