KEGG   Bacillus toyonensis: Btoyo_4068Help
Entry
Btoyo_4068        CDS       T02901                                 

Definition
(GenBank) Sirohydrochlorin ferrochelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
bty  Bacillus toyonensis
Pathway
bty00860  Porphyrin and chlorophyll metabolism
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bty00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Btoyo_4068
Enzymes [BR:bty01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Btoyo_4068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-ProteinID: AHA09939
Position
3983580..3984332
Genome map
AA seq 250 aa AA seqDB search
MKAILYICHGSRLRAAKEEAIQFITTCMSRIEAAIQEVCFLELANPSIEEGFRTCAKRGA
TEIIAIPVFLLAAGHVKNDIPFELQKLNNQYPNIKVTYGNPFGVSETLIKSVYNGSGIEE
YKDEVTLLLVARGSSDPETLQDINRIATLFQAEEKIAKVEVCFLAAAEPKFEEKLKEVVE
RKEGCIIVLPYLLFTGLLMKHIEKEVRQYELDEIKISPYLGKNEVVQDMLIQKTKELLKG
DSYVSTYSAS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcttatatatatgtcatggaagtcgtttgagggcagcgaaagaagaggca
attcaatttattacgacatgtatgagccgtatagaagcggctattcaagaagtttgtttt
ttagagctggcgaatccttctattgaagaaggatttcgtacatgtgcgaagcgtggtgcg
acagagattattgctattcctgttttcttattagcagcaggccatgtgaagaatgatatt
ccttttgaattacaaaagttaaataatcaataccctaatattaaagtgacgtatggtaat
ccgtttggtgtatcagagacgcttataaagtcggtatataacggaagtggtattgaagaa
tataaagatgaagtaacacttttactcgttgcaaggggtagtagcgatcctgaaacttta
caagatataaatcggatcgctactttatttcaagcagaagaaaaaattgctaaagtagaa
gtttgttttttagcagctgcggagccgaaatttgaggagaaattaaaggaagttgtagag
cgaaaagaagggtgtattattgtattaccttatttgttatttacaggcttacttatgaaa
catattgagaaagaagtgcgtcaatatgagttggatgagataaaaataagtccgtattta
ggaaaaaatgaagtggttcaagatatgttaattcagaaaacgaaggagttattgaaggga
gattcatatgtatccacttacagtgcaagttaa

DBGET integrated database retrieval system