KEGG   Bacillus toyonensis: Btoyo_4093Help
Entry
Btoyo_4093        CDS       T02901                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bty  Bacillus toyonensis
Brite
KEGG Orthology (KO) [BR:bty00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Btoyo_4093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Cnd3
Motif
Other DBs
NCBI-ProteinID: AHA09964
Position
complement(4006290..4007288)
Genome map
AA seq 332 aa AA seqDB search
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIIMAAIMNFLGAMTF
TGVAKTITKDIVDPFALQNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAI
AAAGISSLNLKGFIKILEALIISPIIAFVIGYIVYSIFKVVFKNFNLTKTNKNFRIFQIF
TAALQAYTHGTNDAQKAMGIITMALMANNYHTSSDIPFWVQLSCAIAMGLGTSVGGWKII
KTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKW
GTAKRMLITWVITLPISASLAALFYYLLHLIF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacactcttgatactgaccgttttagtagtcatttgcgctttagcttttgacttt
atcaatggatttcacgatacagcaaacgctattgcaacggctgtttcaacgaaagctcta
aagcctagacatgcaattattatggcagctattatgaactttttaggtgcaatgacattt
acaggtgtagcaaaaacgattacaaaagatatcgttgacccatttgctttacaaaatggt
tctcttgtaattttagctgctttacttgcggcgatagcttggaacttaattacttggtac
tacggtatcccaagtagttcttcgcatgcaattattggctcaatcgcaggtgcagctatt
gctgctgctggtattagttcattaaaccttaaaggattcattaaaattcttgaagcttta
atcatttcaccgattatcgcttttgttattggttatatcgtatacagtatttttaaagtg
gtctttaaaaactttaacttaacgaaaacgaataaaaacttccgtatattccagattttc
actgcagcattacaagcttatacacatggtacaaatgatgcacaaaaagcaatgggaatc
attacgatggctcttatggccaataactatcatacttctagcgacatcccgttctgggta
caattatcttgtgcaattgcaatgggtcttggtacttctgtcggtggatggaaaattatt
aaaactgtcggtggacaaattatgaaaattcgtcctgtaaatggtgtagctgctgattta
tcatcatcacttgttattttcggtgcaacattcattcacttgccagttagtacaacgcac
gttatctcttcttctattttaggggttggtgcttctcatcgtgtgaaaggtgtaaaatgg
ggaactgcaaaacgcatgttaattacttgggttattacacttcctatttcagcttcatta
gctgcgttattttactacttattacacttaatcttttaa

DBGET integrated database retrieval system