KEGG   Bacillus toyonensis: Btoyo_4504Help
Entry
Btoyo_4504        CDS       T02901                                 

Definition
(GenBank) Tryptophan 2-monooxygenase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
bty  Bacillus toyonensis
Pathway
bty00260  Glycine, serine and threonine metabolism
bty00330  Arginine and proline metabolism
bty00340  Histidine metabolism
bty00350  Tyrosine metabolism
bty00360  Phenylalanine metabolism
bty00380  Tryptophan metabolism
bty01100  Metabolic pathways
bty01110  Biosynthesis of secondary metabolites
Module
bty_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bty00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Btoyo_4504
   00330 Arginine and proline metabolism
    Btoyo_4504
   00340 Histidine metabolism
    Btoyo_4504
   00350 Tyrosine metabolism
    Btoyo_4504
   00360 Phenylalanine metabolism
    Btoyo_4504
   00380 Tryptophan metabolism
    Btoyo_4504
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     Btoyo_4504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 Pyr_redox HI0933_like FAD_binding_3 FAD_binding_2 Thi4 FAD_oxidored AlaDh_PNT_C ApbA DAO UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AHA10373
Position
4434655..4436091
Genome map
AA seq 478 aa AA seqDB search
MGNPLSMEQMLQIVHEGLAKTNNPKQITVAGAGISGLVAGSLLKEAGHEVTIIEANNRIG
GRVYTIREPFSAGLYFNAGPMRIPDTHELTLAYIRKFKLPLNLFINKTFADIIYTNHIQT
RLNVFEYDPSILEYPVLDKERGKTAEELMLEVLEPILNYIKKDPNKNWFIVEKKYKTYSL
GLFLMEYYSDGAIDMIGVLLDMEAYMGMSLIEVLREMIFFTSTAKYYEITGGMDALPNAF
LPQLKDNIFMSYKVEKIIQEDNKVMLQVKHEQTLDPFTITSDIAIITIPFSALRFVEVQP
FHLFTYFKRRAIRELNYIAATKIAIEFKSRFWERVGQYGGKSITDLPIRFTYYPSYGIQS
PGAAIVIASYTWADEALTWDSLPHRERIRYALKNLAQIYGNVVYSEFITGESFSWSKNTY
SCGAFTAFEPGQELELFPYIASPAGNVHFAGEHTTLTHGWMQGAIESGIRVAHEVNEK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggggaatccattatcgatggaacaaatgcttcaaattgttcatgaagggcttgccaaa
acgaataaccccaaacaaattacagttgccggtgcagggatttctggattagttgcaggt
tctttattgaaagaggctggacatgaagtaacgattatagaagcaaataacagaataggt
ggcagggtgtatacgattcgtgaaccgtttagtgcgggtttatactttaatgcaggaccg
atgagaattcctgatacgcatgagttaactttagcgtatattcgtaaatttaaactaccg
ttaaacctttttataaataaaacttttgcagatatcatttatacgaatcatattcaaacg
agattgaatgtgtttgaatatgatccaagtatacttgaatatccggttttggataaagaa
agaggaaaaacggcagaagagctaatgcttgaagtattagaaccaatactaaattatatt
aagaaggatcctaataaaaactggtttatcgttgaaaaaaagtataaaacgtattcgctt
ggtttatttttaatggagtattattcggatggagcaatagatatgattggtgtacttctt
gatatggaagcatatatgggaatgtctttaattgaagtattacgggaaatgatttttttt
acttcaacggcgaaatattacgagataacgggcgggatggatgcattaccaaatgcattt
ttaccacagctaaaggataatatttttatgtcctataaagtagaaaaaataatacaagaa
gataataaagtgatgctgcaagtaaaacatgaacaaacgttagatccatttacaataaca
agtgatattgctattatcacaattccgttttcggcgttacgatttgtagaagttcagcca
tttcatttattcacttattttaaaagacgagcaattcgtgaattaaattatattgctgca
actaaaattgcgatagagttcaaaagtagattttgggaaagagtcgggcagtatggtggg
aaatctattacggatttaccgatacgttttacatattatccgagctatggcattcagtca
ccaggggcagctatcgttatagcaagttatacgtgggcggatgaggctttaacatgggat
agtctcccgcatagagagcgtattcgttacgcattgaaaaatttagcgcaaatatatggg
aatgtagtctatagtgagtttataacaggggaatcttttagctggagtaagaatacgtat
tcttgcggagcatttacagcttttgaaccaggccaagagctagaattatttccttatatt
gcgtcgccggctggaaacgtacactttgcaggagaacatacaacgttgacacatgggtgg
atgcagggagcgattgagtctggaattagagttgctcatgaagtaaatgaaaagtga

DBGET integrated database retrieval system