KEGG   Burkholderia thailandensis H0587: BTL_1225Help
Entry
BTL_1225          CDS       T03113                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00030  Pentose phosphate pathway
btz00480  Glutathione metabolism
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01120  Microbial metabolism in diverse environments
btz01130  Biosynthesis of antibiotics
btz01200  Carbon metabolism
Module
btz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
btz_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
btz_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTL_1225 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTL_1225 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btz04147]
    BTL_1225 (zwf)
Enzymes [BR:btz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BTL_1225 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BTL_1225 (zwf)
Exosome [BR:btz04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BTL_1225 (zwf)
  Exosomal proteins of colorectal cancer cells
   BTL_1225 (zwf)
  Exosomal proteins of bladder cancer cells
   BTL_1225 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHI64131
Position
1:complement(1344029..1345498)
Genome map
AA seq 489 aa AA seqDB search
MHTDSSFTFVLFGGTGDLSMRKILPALFEAHRANMLSETGRIVAVARHAADRDGYLQWVE
EHVKPHAAKAAGRAFDEAAWRSFLERIVYVKLDLGRAEDYALLRDTVGGLSGIRVFYLAT
GPSLFVPICKALAAVGLNEGARIVLEKPLGYDLRSSNAINDAVGEIFAEDQIYRIDHYLG
KEPVQNLLALRFGNALFEPLWRREWVESIQITIAEELGVEARGDFYDNTGALRDMVQNHL
LQLLSIVAMEPPHSMDSDSVRDEKLRVLRALKPVDPRDIGKVAVRGQYHAGVIKGAQVPA
YATEPGVKADSQTETFVALKVEIENWRWAGVPFFLRTGKRLADRVAEIVVNFRPVPHSAL
GPTALRAGANRLVIRLQPNESIRLYCLAKQPGEGMNLASVHLDLAFDQFFKEGQMEAYQR
LLLDVINGRLALFVRRDEQEAAWRWVEPILNEWARSTKPPKPYAAGTWGPAAASAMLAQH
GTCWLEEEN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgattcgagcttcaccttcgttctcttcggcggcaccggcgatctgtcgatg
cgcaagatcctccccgcgctcttcgaagcgcatcgcgcgaacatgctgtcggaaaccggc
aggatcgtcgccgtggcccgccatgcggcggatcgcgacggctacctgcagtgggtcgaa
gagcacgtgaagccgcatgcggcgaaggcggcgggccgcgcgttcgacgaagcggcctgg
cgaagctttctcgagcgcatcgtctacgtgaagctcgacctcggccgcgcggaagattac
gcgctgctgcgcgacacggtcggcgggctctcgggcattcgcgtgttctacctggcgacg
ggcccgtcgctcttcgtgccgatctgcaaggcgctcgccgccgtgggcctgaacgagggc
gcgcggatcgtgctcgagaagccgctcggctacgatctgcgctcgtcgaacgcgatcaac
gacgcggtgggcgagatcttcgccgaagatcagatctaccggatcgaccactatctcggc
aaggagccggtgcagaacctgctcgcgctgcgcttcggcaatgcgctgttcgagccgctg
tggcgccgcgaatgggtggagagcatccagatcacgatcgccgaggagctgggcgtcgag
gcgcgcggcgatttctacgacaataccggcgcgctgcgcgacatggtgcagaaccacctg
ctgcagctgctttcgatcgtcgcgatggagccgccgcactcgatggattccgattcggtg
cgcgacgagaagctgcgcgtgctgcgcgcgttgaagcccgtcgatccgcgcgacatcggc
aaggtggcggtgcgcggccaataccacgcgggcgtgatcaagggtgcgcaggtgcccgcg
tacgcgaccgagcccggcgtgaaggcggacagccagaccgagacgttcgtcgcgctgaag
gtcgagatcgagaactggcgctgggccggcgtgccgttcttcctgcgcaccggcaagcgc
ctcgccgaccgcgtcgcggagatcgtcgtcaacttccgcccggtgccgcactcggcgctc
gggcccaccgcgctgcgcgcgggcgcgaaccgcctcgtgatccggctgcagccgaacgaa
tcgattcgcctgtactgcctcgcgaagcagccgggcgaagggatgaatctggcgagcgtg
cacctcgacctcgcgttcgaccagttcttcaaggaaggccagatggaggcgtaccagcgc
ctgttgctcgacgtgatcaacggccgcctcgccctcttcgtgcggcgcgacgagcaggaa
gccgcatggcgctgggtcgagccgatcctgaacgaatgggcgcgctcgacgaagccgccg
aagccgtacgcggccggcacctgggggcccgcggccgcgagcgcgatgctcgcgcagcac
ggcacctgctggctcgaggaagaaaactga

DBGET integrated database retrieval system