KEGG   Burkholderia thailandensis H0587: BTL_14Help
Entry
BTL_14            CDS       T03113                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00071  Fatty acid degradation
btz00072  Synthesis and degradation of ketone bodies
btz00280  Valine, leucine and isoleucine degradation
btz00310  Lysine degradation
btz00362  Benzoate degradation
btz00380  Tryptophan metabolism
btz00620  Pyruvate metabolism
btz00630  Glyoxylate and dicarboxylate metabolism
btz00640  Propanoate metabolism
btz00650  Butanoate metabolism
btz00900  Terpenoid backbone biosynthesis
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01120  Microbial metabolism in diverse environments
btz01130  Biosynthesis of antibiotics
btz01200  Carbon metabolism
btz01212  Fatty acid metabolism
btz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTL_14
   00630 Glyoxylate and dicarboxylate metabolism
    BTL_14
   00640 Propanoate metabolism
    BTL_14
   00650 Butanoate metabolism
    BTL_14
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTL_14
   00072 Synthesis and degradation of ketone bodies
    BTL_14
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTL_14
   00310 Lysine degradation
    BTL_14
   00380 Tryptophan metabolism
    BTL_14
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTL_14
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTL_14
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTL_14
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btz04147]
    BTL_14
Enzymes [BR:btz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTL_14
Exosome [BR:btz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTL_14
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHI65134
Position
1:17157..18350
Genome map
AA seq 397 aa AA seqDB search
MTTVDQDPIVIASAARTPIAGFQGDFASLAAPQLGAVAIAAALERAGLKPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTVNKMCGSGMRAAMFAHDMLIAGSVDVVVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSREA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDTVVARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGVTPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFDKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHDKVNVNGGACALGHPIGASGA
RILVTLIGALRARAAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgttgatcaggacccgatcgtcatcgcgtcggcggcgcgcacgccgatcgcg
ggctttcagggcgacttcgcgtcgctcgccgcgccgcagctgggcgcggtcgcgatcgcc
gcggcactcgagcgcgcgggcctgaaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgcgggacagggacaggccccggcgcggcaggccgcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacggtcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcatcgcgggctcggtcgacgtggtcgtcgcgggcggcatg
gaaagcatgacgaatgcgccgtacctgctgccgaaggcgcgcgcgggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cgcctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgaggcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcatgggaaatcgcgcccgtcacggtggccggcaagaagggcgacacggtggtcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagatcccgaccctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaacaggctgggcgtcacgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaagcgccgtcgaagttcacgacggcgcccgtcggcgcg
atccggcgcctgttcgacaagaacggctggcgcgcggccgaggtcgacctctacgagatc
aacgaggcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgac
aaagtcaacgtcaacggcggcgcatgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcgcggccaagcgcggcgtcgcg
agcctgtgcatcggcggcggcgaggcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system