KEGG   Burkholderia thailandensis H0587: BTL_1906Help
Entry
BTL_1906          CDS       T03113                                 

Definition
(GenBank) nucleoside diphosphate kinase family protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00230  Purine metabolism
btz00240  Pyrimidine metabolism
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01130  Biosynthesis of antibiotics
Module
btz_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
btz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
btz_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
btz_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BTL_1906
   00240 Pyrimidine metabolism
    BTL_1906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:btz04131]
    BTL_1906
Enzymes [BR:btz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BTL_1906
Membrane trafficking [BR:btz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BTL_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AHI64487
Structure
PDB: 

Position
1:2106547..2106972
Genome map
AA seq 141 aa AA seqDB search
MALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFF
KDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD
APETARVEIAFFFPEMNVYSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgagcgcaccctgtcgatcatcaagccggatgcggtggcgaagaacgtgatc
ggccagatctacagccgtttcgaaaacgccggcctgaagatcgtggcggcgcgcatggcg
cacctgtcgcgcgccgatgcggagaagttctacgccgtgcacgccgagcgtccgttcttc
aaggatctcgtcgaattcatgatctcgggcccggtgatgatccaggttctggaaggcgag
gacgcgatcctgaagaaccgcgacctgatgggcgcgacggatccgaagaaggcggaaaag
ggcacgatccgcgccgacttcgcggacagcatcgacgcgaacgccgtgcacggctcggac
gcaccggaaacggcgcgcgtcgagatcgcgttcttcttcccggaaatgaacgtctactcg
cgctaa

DBGET integrated database retrieval system