KEGG   Burkholderia thailandensis H0587: BTL_3159Help
Entry
BTL_3159          CDS       T03113                                 

Definition
(GenBank) alpha/beta hydrolase fold family protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00903  Limonene and pinene degradation
btz00930  Caprolactam degradation
btz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTL_3159
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BTL_3159
Enzymes [BR:btz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BTL_3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AHI63855
Position
1:complement(3577947..3578912)
Genome map
AA seq 321 aa AA seqDB search
MSWQSKVACWLLRRQFRPETLRPVIDPARARRLTKLRMRVPRRPPAGWRLRERYGAGDAP
LRGEWLERADAVPVRAQHGRMLLYFHGGGYYFCSPQTHRPLVFALTRHAGVRSFSLDYRL
APEHPFPAALDDALAAYRQLVSAGTPPESIVFGGDSAGGGLALAALVALRDAGDPLPAGA
VLFSPWTDLAATGDTLRTHDGLDPMFAGAALGRAARLYLGDTPGTHPHASPLYADFTGLP
PLFIQAGSTEVLLDDSRRVADKARAAGVHVELEIWPQMPHVWQIYVPFVPESARALERAA
AFVRRIAVERATQRTADASIA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcagagcaaagtcgcgtgctggctgctgcgccggcagtttcgtcctgagacg
ctgcgcccagtgatcgacccggctcgcgcgcggcggctgacgaagctgcggatgcgcgtg
ccgcgccgcccgcccgccggctggcggctgcgcgagcgctacggcgccggcgacgcgccg
ctgcgcggcgaatggctcgagcgcgcggacgccgtgcccgttcgcgcgcagcatggccgg
atgctgctgtatttccacggcggcggttattacttctgctcgcctcagacgcaccgcccg
ctcgtgttcgcgctgacgcggcacgcgggcgtgcgctcgttctcgctcgactaccggctc
gcacccgagcatccgtttccggccgcgctcgacgacgcgctcgccgcgtaccggcaactc
gtgtccgccggcacgccgccggagtcgatcgtgttcggcggcgattcggcgggcggcggc
ctcgcgctcgccgcgctcgtcgcgctgcgcgacgcgggcgacccgctgccggcgggcgcg
gtgctgttctcgccgtggaccgatctcgccgcgacgggcgatacgctgcgcacgcacgac
gggctcgatccgatgttcgcgggcgcggcgctcggccgcgcggcgcgcctgtatcttggt
gacacgccgggcacgcatccgcatgcgtcgccgctgtatgcggatttcacgggattgccg
ccgcttttcatccaggcgggcagcaccgaggtgctgctcgacgattcgcggcgcgtcgcc
gacaaggcgcgcgcggcgggcgtgcacgtcgaactagagatatggccgcagatgccgcac
gtatggcagatctacgtgccgttcgtgcccgaatcggcgcgtgcgctcgagcgggcggcc
gcgttcgtgcggcgcatcgcggtcgagcgcgcgactcagcgcacggccgacgcgtcgatc
gcctga

DBGET integrated database retrieval system