KEGG   Burkholderia thailandensis H0587: BTL_4244Help
Entry
BTL_4244          CDS       T03113                                 

Definition
(GenBank) amidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00330  Arginine and proline metabolism
btz00360  Phenylalanine metabolism
btz00380  Tryptophan metabolism
btz00627  Aminobenzoate degradation
btz00643  Styrene degradation
btz01100  Metabolic pathways
btz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BTL_4244
   00360 Phenylalanine metabolism
    BTL_4244
   00380 Tryptophan metabolism
    BTL_4244
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTL_4244
   00643 Styrene degradation
    BTL_4244
Enzymes [BR:btz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BTL_4244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHI68382
Position
2:1067444..1068901
Genome map
AA seq 485 aa AA seqDB search
MKLSEYADYDAVGLARLIAHGDVSAAELARTAGEAIEAVNPAVNAVVEHWPADAAGPTAA
AGSGPLAGVPFLIKDLALPMAGKRMELGSRLAAGLVSPSDSMLMRRLRAAGLVTLGRTAT
PEMAFSTATESVQFGATRNPWNLALSAGGSSGGAAAAVAAGIVPLAHATDAAGSIRVPAA
FTGLFGLKPTRGRISNGPELDEVFAGLGVQGGLSRTVRDSAALLDAMHGTAAGEPYHTSA
PAQTFLSEVGRDPGRLRIGLMLEPFDGARAAPAMTQATLDAAGHLEMLGHDIEPITPVLG
ASWEAFVLATARIWCATLVGWIDGVAAATARPIDGTTLEPSTLAAYRYGKQVTGPDFASA
LAVRNAVTRSTADWFRRVDVLLSPTMPNLPEAIGDYYVGAQRTDGLQWTERLFRHSPYTP
VFNVAGLPAMSVPLFHDEASGLPIGVQFGAGFAQEATLLRLAGQLEQTIPWRRRRPAVWA
GSCAT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagcgaatacgccgattacgatgctgtcggactggcccggctgatcgcgcac
ggcgacgtcagcgcggccgagctggctcgtacggccggcgaagcgatcgaagcggtcaat
cccgccgtcaacgcggtggtcgagcactggcccgccgacgcggcggggcccacggccgcc
gccggcagcggcccgctcgcgggcgtgccgttcctgatcaaggatctggcgctgccgatg
gcgggcaagcggatggagctcggctcgcggctggcggcgggactcgtgtcgccgtcggat
tcgatgctgatgcgacgcttgagggcggccggcctcgtgacgctcggccgcaccgccacg
ccagagatggcgttcagcaccgccaccgaatcggtgcagttcggtgcgacgcgcaatccg
tggaacctcgccctcagcgcgggcggctccagcggcggagcggccgccgccgtcgccgcc
ggcatcgtgccgctcgcgcatgcgaccgatgcggccggatcgatccgggtgccggcagcc
ttcaccggactcttcggactgaagccgacgcgcggccgtatttccaacgggccggagctc
gacgaagtcttcgccgggctcggcgtgcaaggcggcctgagccgcacggtgcgagacagc
gccgcgctgctcgacgcgatgcacggcacggcggcgggcgagccgtatcacacgagcgcg
ccggcccagacgttcctctccgaggtgggccgcgatccgggacggctgcgcatcgggctg
atgctggaaccgttcgacggcgcgcgcgccgcgccggcaatgacgcaagcgacgttggat
gcggccggtcacctggaaatgctgggccacgatatcgaaccgataacacctgtgctcggc
gcgtcgtgggaggcgttcgtgctcgccaccgcgcggatatggtgcgccacgctcgtaggc
tggatcgacggcgtcgccgccgcgacggcccggccgatcgacggcacgacgctggagcct
tcgacgctcgcggcataccgttacggcaagcaggtcaccgggccggacttcgcgagcgcg
ctggcggtgcgcaatgccgtgacgcgcagcacggccgactggttccggcgcgtcgacgtg
ctgctgtcgccgacgatgccgaatctgccggaagcgatcggcgactattacgtcggcgcg
caacggacggacggcctgcaatggaccgaacgcctgttccgtcactcgccgtacacgccg
gtcttcaacgtggcggggctgcccgccatgtccgtgccgctcttccacgacgaggcgtcc
ggcctgccgatcggcgtgcagttcggcgccggcttcgcgcaggaagccacgctgctgcgg
ctcgccgggcagctcgagcaaaccatcccgtggcgccgccgccggccggcggtgtgggcc
ggctcctgcgccacctga

DBGET integrated database retrieval system