KEGG   Burkholderia thailandensis H0587: BTL_4262Help
Entry
BTL_4262          CDS       T03113                                 

Definition
(GenBank) thiamine pyrophosphate enzyme, central domain protein
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00290  Valine, leucine and isoleucine biosynthesis
btz00650  Butanoate metabolism
btz00660  C5-Branched dibasic acid metabolism
btz00770  Pantothenate and CoA biosynthesis
btz01100  Metabolic pathways
btz01110  Biosynthesis of secondary metabolites
btz01130  Biosynthesis of antibiotics
btz01210  2-Oxocarboxylic acid metabolism
btz01230  Biosynthesis of amino acids
Module
btz_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
btz_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BTL_4262
   00660 C5-Branched dibasic acid metabolism
    BTL_4262
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BTL_4262
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BTL_4262
Enzymes [BR:btz01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BTL_4262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AHI66547
Position
2:complement(1088497..1090170)
Genome map
AA seq 557 aa AA seqDB search
MSNKTTTTVGELIAAFLEQCGVKTAFGVISIHNMPILDAIHSRGKIRYVGARGEAGAVNM
ADGLARVSGGLGVAFTSTGTAAGNAAGAMVEALTAGTALVHITGQIETPYLDQDLAYIHE
APDQLSMLNAISKAAYRVRTVETVLPTIREAVRVAMTAPSGPVSVEIPIDIQAAEIEWPD
DLAPPHVAVREHDSARVAQLAERLANARRPLLWLGGGARHARAEVERLVALGFGVVTSVQ
GRGVLPEDHPATLGAFNVHAAVERFYKTCDALVVVGSRLRGNETLKYKLALPSPLFRVDA
DALADNRGYRNDLFVHGDAKRVLAELADRLEGKLAVDPRFADDLAAAREAAVADVGKGLG
PYKRLVDTLQQALGRDYNWVRDVTISNSTWGNRLLRIFEPRAGVHALGGGIGQGMQMAIG
AALAGVAAKTVCLVGDGGLMVNVGELATAVQESANVMIVLMNDQCYGVIRNIQDAQYGGR
RCYVDLHQPDFAQFCASLKLAHHRITSLDDAERIVREGLAHEGPVLVEVDMLSVGSFATA
FAGPPVKKDTPAERQYA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacaaaaccacgaccacggtcggcgagctgattgccgccttcctcgaacaatgc
ggcgtgaaaaccgccttcggcgtgatctcgattcacaacatgccgatcctcgacgcgatc
cattcgcgcggcaagatccgctacgtcggcgcgcgcggcgaggcgggcgccgtcaacatg
gcagacggcctcgcgcgcgtgtcgggcgggctcggcgtcgcgttcacgagcacgggcacc
gcggcgggcaacgcggcgggcgcgatggtcgaggcgctgacggccggcaccgcgctcgtg
cacatcaccgggcagatcgagacgccttatctcgatcaggatctcgcgtacatccacgaa
gcgccggatcaactgtcgatgctcaacgcgatctcgaaggccgcgtatcgcgtgcgcacg
gtcgaaaccgtgctgccgacgatccgcgaggcggtgcgtgtcgcgatgaccgcaccgagc
ggccccgtgtcggtcgagattccgatcgacatccaggcggccgagatcgagtggccggac
gacctcgcgccgccgcacgtcgcggtgcgcgagcacgatagcgcgcgcgtcgcgcagctc
gccgagcgtctcgcgaacgcgcgccggccgctgctgtggctcggcggcggcgcgcggcac
gcgcgcgcggaagtcgagcggctcgtcgcgctcggcttcggcgtcgtcacgagcgtacag
gggcgcggcgtgctgcccgaggatcatccggcgacgctcggcgcgttcaacgtgcacgcg
gccgtcgagcgcttctacaagacgtgcgacgcgctcgtcgtggtgggctcgcggctgcgc
ggcaacgagacgctgaagtacaagctcgcgctgccgagcccgctgttccgcgtcgatgcc
gacgcgctcgccgacaaccgcggctatcgcaacgatctgttcgtgcacggcgatgcgaag
cgcgtgctcgccgagctcgccgaccggctcgaaggcaagctcgccgtcgatccgcgcttc
gccgacgatctcgcggccgcgcgggaggctgccgtcgccgacgtcggcaaggggctcggc
ccgtacaagcgcctcgtcgacacgctgcagcaggcgcttggccgcgactacaactgggtg
cgcgacgtgacgatctcgaacagcacgtggggcaaccgcctgctcaggatcttcgagccg
cgcgcgggcgtgcatgcgctgggcggcggaatcgggcaggggatgcagatggcgatcggc
gcggcgctcgccggcgtggcggcgaagactgtgtgcctcgtcggcgacggcggcctgatg
gtcaacgtcggcgagctcgcgaccgccgtgcaggaaagcgcgaacgtgatgatcgtgctg
atgaacgaccagtgctacggcgtgatccgcaacatccaggacgcgcagtacggcggccgc
cgctgctacgtcgatctgcatcagccggatttcgcgcagttctgcgcgagcctgaagctc
gcgcatcaccggatcacgtcgctcgacgacgcggagcgcatcgttcgcgaggggctcgcg
cacgaaggcccggtgctcgtcgaggtcgacatgttgtcggtcggttcgttcgcgaccgcg
ttcgcggggccgcccgtcaagaaggacacgcccgcggagcgtcagtatgcgtaa

DBGET integrated database retrieval system