KEGG   Burkholderia thailandensis H0587: BTL_4640Help
Entry
BTL_4640          CDS       T03113                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
btz  Burkholderia thailandensis H0587
Pathway
btz00625  Chloroalkane and chloroalkene degradation
btz00680  Methane metabolism
btz01100  Metabolic pathways
btz01120  Microbial metabolism in diverse environments
btz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BTL_4640 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTL_4640 (fdhA)
Enzymes [BR:btz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BTL_4640 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AHI67639
Position
2:complement(1595992..1597191)
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYQGPGKVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLRIGDLVSVPFNVACGRCAMCKEQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMAKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAERLAHAKAMGFEVVDLSKD
ATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAVDAAAKHGSLSIRFGLGWAKSHSFHTGQTPVLKYSRNLMQAILFDRLPIA
QIVNVTVISLDDAPEGYRKFDGGAPRKFVIDPHGMLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaccgaggtgtcgtgtatcaagggccgggcaaggtcgaggtgcagaagatc
gactatccgaagatggttgatccgagcggccgcgcgatcggccacggcgtgatcctgaag
gtcgtcagcacgaatatctgcggctccgatcagcacatggtgcgcggccgcaccacggcg
cctgtcggtctcgtgctcggtcacgagatcacgggcgaggtggtcgaggtgggccgcgac
gtcgagacgctgaggatcggcgatctggtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggagcagcacacgggcgtgtgcctgaacgtgaatccgtcgcgcgcg
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggtcaggccgaatacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatggcg
aagatccgcgatctcacgtgtctgtcggacatcttgccgaccggctatcacggcgcggtc
acggccggcgtgaagcccggctcgacggtctacgtcgcgggcgcgggcccggtcgggatg
gcggccgccgcgtcggcgcgcctgctcggcgccgcgtgcacgatcgtcggcgacatgaac
gccgaacgtctcgcacacgcgaaggcgatgggcttcgaagtcgtcgatctgtcgaaggac
gcgacgctcggcgagcagatcgagcagattctgggcaagccggagatcgattgcgcagtc
gactgcgtcggcttcgaggcgcacgggcacggttcgtccggtcacgcggaggaggcgccc
gcaacggtgctgaactcgctgatggagatcacgcggcccgcgggcgcgatcggcattccc
ggcctgtacgtgaccgacgatccgggcgccgtcgacgccgccgcgaagcacggcagcctg
agcatccgcttcggcctcggttgggcgaagtcgcactcgttccataccggccagacgccc
gtgctcaagtacagccgcaatctgatgcaagcgatcctgttcgaccggctgccgatcgcg
cagatcgtcaacgtgacggtgatttcgctcgacgatgcgccggaaggctacaggaagttc
gacggcggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system