KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01460Help
Entry
CWO_01460         CDS       T01828                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
bua00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bua01100  Metabolic pathways
bua01110  Biosynthesis of secondary metabolites
bua01130  Biosynthesis of antibiotics
bua01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bua00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CWO_01460
Enzymes [BR:bua01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CWO_01460
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CWO_01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI CBM26 QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADP66098
Position
complement(305115..306476)
Genome map
AA seq 453 aa AA seqDB search
MQDTTLKKIIQDKSEWIRLRKEKQPLIDFKDKINKKTRDFYHSLKEKKPCFILEYKKKSP
SLGIIRNNFNLIEISNVYKKYASSVSVLTDEKYFHGNLNFINIVRECVSQPVLCKDFFID
PYQVYLSRYYNADAILLMLSVLNDIQYKELSIIAKKLNMGILTEVNNIEELKRALKLNAN
IIGINNRNLHDLSIDLNRTRTLSSLIKKDTIIISESGIKKYREIKELSKFVNGFLIGSHL
MSQTNLETAVRSIIFGDNKVCGLTRSIDIEVSEKYGAIYGGLIFVKNSPRYITKKTAKNI
SINRKLKLIGIFQNENINIIVDIAEELSLYGVQLHGQENKQYIDKLRNILPKKINIWKAF
SIQSELPDRNWDNVNMYIFDSDSGGSNTSFNWSILNHHILDNVILAGGINLKNCITASKL
KCSGLDLNSGVEISPGIKDCKKIKSIFQKLRYG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacacaacacttaaaaaaattatacaagataaaagtgaatggattagattaaga
aaagaaaaacagcctttaattgattttaaagataaaataaataaaaaaacacgggatttt
taccattctttaaaagaaaaaaaaccatgttttatattagaatataaaaagaaatctcct
tctttaggtattattagaaacaattttaatttaattgaaatttctaatgtttacaaaaaa
tatgcatcttctgtttcagtcctaacagatgaaaaatattttcatggaaatttaaatttt
ataaatatagtaagagaatgtgtttctcaacctgttttatgcaaagatttttttattgat
ccatatcaagtatatttatctagatattataatgcagatgctattttattaatgttatct
gttttaaatgatatacagtataaagaactatctataattgcaaaaaaattaaatatgggc
atactaactgaagtaaataatatagaggaattaaaacgtgctctaaaattaaatgctaat
attataggtattaacaatcgcaatttgcatgatttatcaattgatttaaatcgtacacgt
actttatcttctttaattaaaaaagatactataataataagcgaatcaggtataaaaaaa
tatagagaaataaaagaacttagtaaatttgtcaatggttttttaattggttctcatttg
atgtctcaaactaatttagagacagccgttcgttctataatttttggtgataataaagtc
tgcggattaactcgtagtatagatatagaagtttctgaaaaatacggagcaatttacggc
ggacttatttttgtaaaaaattctcctcgttatattactaaaaaaactgcaaaaaatatt
tctataaatagaaaattaaaattgatcggaatttttcaaaatgaaaatatcaatattatc
gtagatattgctgaagaactatcactttatggtgtacaactgcatggacaagaaaataaa
caatatattgataaattaaggaacatactacctaaaaaaatcaatatttggaaagctttt
tctattcaatcagaattgccagatcgcaattgggacaatgtaaatatgtatatatttgac
tctgattctggaggaagtaatacatcttttaattggtctattttaaaccatcatatttta
gataatgttattttagctggaggaattaatttaaagaattgtattacagcttctaaacta
aaatgctcaggattagatttaaattccggcgtagaaatatctcctggcattaaagactgc
aagaaaataaaatcaatttttcaaaaattaagatatggttaa

DBGET integrated database retrieval system