KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01580Help
Entry
CWO_01580         CDS       T01828                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
bua00020  Citrate cycle (TCA cycle)
bua00310  Lysine degradation
bua01100  Metabolic pathways
bua01110  Biosynthesis of secondary metabolites
bua01120  Microbial metabolism in diverse environments
bua01130  Biosynthesis of antibiotics
bua01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bua00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CWO_01580
  Amino acid metabolism
   00310 Lysine degradation
    CWO_01580
Enzymes [BR:bua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CWO_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ADP66122
Position
337030..338292
Genome map
AA seq 420 aa AA seqDB search
MKKINILVPDLPESISDATVVKWHKKIGDTVHCDDNIVDLETDKVMLEVSSPCDGILQSI
LEKEGKVVISQQTLGEINKSTVVDNHLSNNHIIEKEDNLLKKEEKYITTEEKKEIEYLLK
DNHKHLTPSMRRSVKIHNINNGFLNQVIETSKKTNFENIIKEEKKESNQILFNHNIFNVN
ENNKNNNNKVTNRVKMTRLRQRIAERLLDSKNNTAMLTTFHEVNMKPIILLRKKYGEDFE
KKHNVRIGFMSFFVKAVIQALKNFPEINAYIDQTDIVFYKNFDISIAISTPRGLITPVIR
NADTMTMAEIEKKIKDFSMKGLQNKINIKELMGGNFTITNGGVFGSLMSTPIINPPQTAI
LGMHVIQERPVVVNGQIKILPMMYLALSYDHRLIDGKESVGFLINIKNILEDFNRIAIDV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatattcttgttccagatttaccagaatctattagtgatgcaacagtt
gtaaaatggcacaaaaaaataggagatacagttcactgtgatgataatatagttgatctt
gaaacagataaagtcatgttagaagtatcttctccatgtgatggaatattacaatcaatt
ttagaaaaagaagggaaagtagttatatctcaacaaacacttggtgaaataaacaaatct
actgtggttgataaccatctttccaataatcatattattgaaaaagaagataatttatta
aaaaaagaagaaaaatatataactacggaagaaaaaaaagaaatagaatatttattaaaa
gataatcacaaacatctgactccatctatgagacgatcagtcaaaatacataatattaat
aatggttttttaaatcaagtgatcgaaacaagtaaaaaaactaattttgaaaatattata
aaagaagaaaaaaaagaatcgaatcaaattttattcaatcataatatatttaatgttaat
gaaaataataaaaataataataataaggttacgaatcgagtaaaaatgactcgattacga
caaagaattgcagaacgattactagatagcaaaaataatacagctatgctaactactttt
catgaagtaaatatgaaaccaatcatacttttacgtaaaaagtatggtgaagattttgaa
aaaaaacataatgttagaattggatttatgtctttttttgtaaaagcagtcattcaagca
ttaaaaaattttccagaaattaatgcttacatagatcaaacagatatagttttttataaa
aattttgacatcagtattgctatttcgacgccaagagggttgattactccggtaataaga
aatgctgatacaatgacaatggcagaaattgaaaaaaaaataaaggatttttctatgaaa
ggattgcaaaataaaatcaatataaaagaattaatgggtggcaatttcaccattactaat
ggtggtgtttttggttccttaatgtcgactcctattattaaccctcctcaaacagccata
ttaggtatgcatgtaattcaagaacgtccagtagttgtaaatggacaaattaaaattctt
ccaatgatgtatttagcattatcttatgatcatcgtttaatagatggaaaagaatctgtc
ggttttttaatcaatataaaaaatatattagaagattttaatcgtattgcaattgatgtg
tag

DBGET integrated database retrieval system