KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01600Help
Entry
CWO_01600         CDS       T01828                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
bua00010  Glycolysis / Gluconeogenesis
bua00051  Fructose and mannose metabolism
bua00562  Inositol phosphate metabolism
bua01100  Metabolic pathways
bua01110  Biosynthesis of secondary metabolites
bua01120  Microbial metabolism in diverse environments
bua01130  Biosynthesis of antibiotics
bua01200  Carbon metabolism
bua01230  Biosynthesis of amino acids
Module
bua_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWO_01600 (tpiA)
   00051 Fructose and mannose metabolism
    CWO_01600 (tpiA)
   00562 Inositol phosphate metabolism
    CWO_01600 (tpiA)
Enzymes [BR:bua01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CWO_01600 (tpiA)
Exosome [BR:bua04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CWO_01600 (tpiA)
  Exosomal proteins of bladder cancer cells
   CWO_01600 (tpiA)
  Exosomal proteins of melanoma cells
   CWO_01600 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADP66126
Position
complement(341097..341864)
Genome map
AA seq 255 aa AA seqDB search
MKKFFITANWKLNGNIKMISSFFKYLKLYSSSYLEKNTVIIAPPTIYLERVCKNISNMNI
FLGSQNVDINLNGAFTGETSILMLRDIGVKYVIIGHSERRFLHHETDDIIAKKFHLIKKS
NLTPILCVGETEIEKKHNQTEQVIQRQLNLILKNLGTSAFKNIIIAYEPIWAIGTGVSAD
PEHVQLIHVFIKNYILKYSSINRNDIIIQYGGSINHTNVKKFIEQPDINGLLIGNSSLSA
KEFLEIIKIAHEHYS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcttcattacagctaactggaaattaaatggaaatataaaaatgatttct
agttttttcaaatatttaaaattatattcatcaagttatttagaaaaaaacactgttatt
attgctcctccaactatatatttagaacgagtatgtaaaaatataagcaatatgaacatt
tttcttggttcgcaaaacgtagatattaatttaaacggagcatttaccggtgaaacttct
attttgatgctgcgagatataggagtaaaatatgtgattatagggcattccgaaagacgt
tttttacatcatgaaactgatgatatcattgcaaaaaaatttcatttaattaaaaaatca
aatttaacacctatattgtgtgtaggtgaaacagaaatagaaaaaaaacataatcaaacc
gagcaggttattcaaagacaattaaatttgatattaaaaaatttaggcacatcagcattt
aaaaatataataattgcctatgaacctatttgggccatcggaactggtgtatcagcagat
ccagaacatgttcaactaatacatgtatttataaaaaattatattttaaaatatagctca
atcaatagaaatgatataataattcaatacggtggatctattaatcatactaatgtaaaa
aagtttattgaacaaccagacatcaatggtttattaattggaaattcatctttaagtgct
aaagaatttttagaaattataaaaatagcacacgaacactattcataa

DBGET integrated database retrieval system