KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_02120Help
Entry
CWO_02120         CDS       T01828                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:bua00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bua03009]
    CWO_02120
Enzymes [BR:bua01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CWO_02120
Ribosome biogenesis [BR:bua03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CWO_02120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ADP66220
Position
complement(439097..440035)
Genome map
AA seq 312 aa AA seqDB search
MKKIQLNSIASSCSLSGQRLDLVLSKLFREYSRSYLKKLIIMNQVLVNESIVNQPDKKIL
GGEILTIHPFSKDLLVDIPENIFLDIVYEDSDILIINKPAGLVVHPGSGNKSGTILNALL
YHYKNSKDLPRAGIVHRLDKDTSGLMVIAKNIFSYNHLLLLLKEKKIIREYEGVVHGKMI
AGGTINKPIMRHYNRRTCMMVHHLGKPSVTHYKVLSRFKFHTHIAIRLETGRTHQIRVHM
LHIKYPLVGDPCYSGFKIQSNYRKDKKTNKIYKFPRQALHANHLSLHHPIKKNVMSWTVP
LPQDIQELLLKI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaatacaattaaattctattgcatcatcttgttcattatcagggcaaagatta
gatctagttttatctaaattatttagagaatattctcgttcttatttaaaaaaattaatt
attatgaatcaggtcttagttaatgaaagtattgtaaatcagcctgataaaaaaatatta
ggaggagagattcttacaattcatcctttttctaaagatttattagttgatatcccagaa
aatatttttttagatattgtgtatgaagatagcgatatattaataatcaataaacctgct
ggattagttgttcatccaggttctggaaataaatcaggaacaattttaaatgctttatta
tatcactataaaaatagtaaagatttacctcgtgctggaatagtgcatcgtttagataaa
gatactagcggattgatggtaattgcaaaaaatattttttcttataaccacttgttatta
ttattgaaagaaaagaaaattattcgagaatatgaaggagttgttcacgggaaaatgatt
gccggtgggactataaacaaacctataatgcgtcattataacagaagaacatgtatgatg
gttcatcatttaggaaaaccatcagtaacacattataaggtcctcagtcgttttaaattt
catacacatatagcaatacgattagaaacggggcgtacgcatcaaattcgagttcatatg
ttgcacatcaaatacccattagttggagatccttgttatagtggttttaaaatccagtca
aattatagaaaagataaaaaaactaataaaatatataaatttcctcgtcaagcactgcac
gcaaaccatctttctcttcatcatcctattaaaaaaaatgtaatgtcatggacagtacca
cttcctcaagatattcaagaactgcttttaaaaatatag

DBGET integrated database retrieval system