KEGG   Burkholderia ubonensis: BW23_2332Help
Entry
BW23_2332         CDS       T03794                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bub  Burkholderia ubonensis
Pathway
bub00220  Arginine biosynthesis
bub01100  Metabolic pathways
bub01110  Biosynthesis of secondary metabolites
bub01130  Biosynthesis of antibiotics
bub01230  Biosynthesis of amino acids
Module
bub_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BW23_2332 (argF)
Enzymes [BR:bub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BW23_2332 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Toxin_31
Motif
Other DBs
NCBI-ProteinID: AJX15766
Position
I:complement(2509219..2510148)
Genome map
AA seq 309 aa AA seqDB search
MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR
LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQEIIQRFAEN
SRVPVINGLTNEFHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIQAAQILGFK
LRLSTPPGYALDMKLVAPESAPFYEVFDDPNEACKGADLVTTDVWTSMGFEAENEARKQA
FADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALME
FLLLGQLKH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaagaccattcgtcactacctgcagttcaaggatttctcgctggaagactac
gagtacgtgctcgaacgcacgggaatcctgaagcgcaagttcaagaactacgagacctat
cacccgctgcacgaccgcacgctcgcgatgatcttcgagaagagctcgacgcgcacgcgc
ctgtcgttcgaggccggcatcttccagctcggcggccatgccgtcttcatgagcacccgc
gacacgcagctcggccgcggcgagcccgtcgaggattccgcgcaggtgatctcgcggatg
gtcgacatcatcatgatccgcacgttcgagcaggagatcatccagcgcttcgccgaaaat
tcgcgcgtgccggtgatcaacggcctgaccaacgaattccacccgtgccaggtgctcgcc
gacatcttcacgtactacgagcaccgcggcccgatcgccggcaagacggtcgcgtgggtc
ggcgacgcgaacaacatgctgtacacgtggatccaggccgcgcagatcctcggcttcaag
ctgcgcctgtcgacgccgccgggctacgcgctcgacatgaagctggtcgcgccggaaagc
gcgccgttctacgaagtcttcgacgatccgaacgaagcgtgcaagggcgccgatctcgtg
acgaccgacgtgtggacgagcatgggcttcgaggccgagaacgaagcacgcaagcaggcg
ttcgccgactggtgcgtcgacgaggaaatgatggggcacgcgaaccccgacgccctcttc
atgcactgcctgcccgcgcaccgtggcgaggaagtgacggccggcgtgatcgacggcccg
cagagcgtggtctgggacgaggcggagaaccgcctgcacgtgcagaaggcgctgatggaa
ttcctgctgctcggccagctcaagcactga

DBGET integrated database retrieval system