KEGG   Burkholderia ubonensis: BW23_2432Help
Entry
BW23_2432         CDS       T03794                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bub  Burkholderia ubonensis
Pathway
bub00860  Porphyrin and chlorophyll metabolism
bub01100  Metabolic pathways
Module
bub_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BW23_2432 (cobC)
Enzymes [BR:bub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BW23_2432 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AJX16593
Position
I:2611555..2612139
Genome map
AA seq 194 aa AA seqDB search
MDVVLIRHPAVAVDPGVCYGRSDVPLAASAQAGAQGVRERLDALRAPLPQRIWSSPLARC
ASVGERLSRALGVPLQYDGCWQEMDFGAWEMQRWDDIDRAALDAWAADLMHACAHGGESV
ARFAARVAQGVDATMQADVPQWAVTHAGVIRAFASQVLRVPLDALLSRPVPFGGIVWLRM
RDAAGAWEVVHWDA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgtcctgatccgccatccggcagtcgccgtcgatccgggcgtgtgttacgga
cgcagcgatgtgccgctcgccgcgtcggcgcaggccggcgcgcagggtgtgcgcgagcgg
ctcgacgcgttgcgcgcgccattgccgcagcgcatctggtcgagcccgctcgcgcgttgc
gcgtcggtcggcgaacggctctcgcgggcgctcggcgtgccgttgcagtacgacggatgc
tggcaggagatggacttcggcgcgtgggagatgcagcgctgggacgacatcgaccgcgcg
gcgctcgatgcatgggccgccgatctgatgcatgcgtgtgcgcatggcggcgaaagcgtc
gcgcgcttcgccgcgcgggtcgcgcaaggcgtcgacgcgaccatgcaggccgacgtgccg
caatgggcagtcacgcatgccggcgtgatccgcgcgtttgcgtcgcaggtgctgcgcgtg
ccgctcgacgcgctgttgtcgcggccggtgccgttcggcggcatcgtgtggctgcgcatg
cgcgatgcggccggcgcgtgggaggtcgtgcactgggacgcgtga

DBGET integrated database retrieval system