KEGG   Burkholderia ubonensis: BW23_3124Help
Entry
BW23_3124         CDS       T03794                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bub  Burkholderia ubonensis
Brite
KEGG Orthology (KO) [BR:bub00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BW23_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJX16885
Position
I:3351503..3352513
Genome map
AA seq 336 aa AA seqDB search
MHSIQLALWMVAALVLVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVAFAAAFNVIAY
FIFHLKVAQTVGKGTIDPGIVDHYVVFGALVGAIAWNVITWYYGIPSSSSHALIGGLVGS
ALAKSGWGSLNIDGLMKTIAFIFISPLLGFILGSLFMLGVSWLYFRTAPSKVDRRFRRLQ
LLSAGLYSLGHGGNDAQKTIGIIWMLLIATGYASAGADAPPAWVIGACYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAETGGAMTLFIASFLGIPVSTTHTITGAIVGVGATQKLS
AVRWGVAGNIVWAWVLTLPASALFAAGGWWLGHRIF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgatacaacttgccctatggatggtcgcggcgctggtgctcgtcgcgctcgta
ttcgacttcatgaacggcttccacgacgcggcgaactcgatcgccaccgtcgtgtccacc
ggggtgctgaagccgcagcaggcggtggcatttgccgccgcgttcaacgtcatcgcgtat
ttcatcttccacctgaaggtcgcgcagaccgtcggcaaaggcacgatcgatcccgggatc
gtcgaccactatgtcgtgttcggcgcgctcgtcggcgcgatcgcctggaacgtgatcacc
tggtactacgggatcccgtcgagttcgtcgcacgcgctgatcggcggcctcgtcggctcg
gcgctcgcgaagtcgggctggggatcgctgaacatcgacgggctgatgaagacgatcgcg
ttcatcttcatctcgccgctgctcggcttcatcctcggctcgctgttcatgctcggcgtg
tcgtggctgtacttccgcaccgcgccgagcaaggtcgaccggcggttccgtcgcctgcag
ctgctgtcggccgggctgtacagcctcggccacggcggcaacgacgcgcagaagacgatc
ggcatcatctggatgctgctgatcgcgaccggctacgcgtcggcgggcgccgacgcgccg
ccggcatgggtgatcggtgcgtgctacctgtcgatgggcctcggcacgctgttcggcggc
tggcggatcgtgcgcacgatgggccagaagatcacgaagctgaagccggtcggcgggttc
tgcgcggagacgggcggcgcaatgacgctgttcatcgcgtcgttcctcggcattccggtg
tcgacgacccatacgatcaccggcgcgatcgtcggcgtcggcgcgacgcagaagctgtcg
gccgtgcgctggggagtcgccggcaacatcgtgtgggcgtgggtgctgacgctgccggcg
tccgcgctgttcgcggcgggcggctggtggctcggccatcggatcttctga

DBGET integrated database retrieval system