KEGG   Burkholderia ubonensis: BW23_3204Help
Entry
BW23_3204         CDS       T03794                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bub  Burkholderia ubonensis
Pathway
bub00071  Fatty acid degradation
bub00072  Synthesis and degradation of ketone bodies
bub00280  Valine, leucine and isoleucine degradation
bub00310  Lysine degradation
bub00362  Benzoate degradation
bub00380  Tryptophan metabolism
bub00620  Pyruvate metabolism
bub00630  Glyoxylate and dicarboxylate metabolism
bub00640  Propanoate metabolism
bub00650  Butanoate metabolism
bub00900  Terpenoid backbone biosynthesis
bub01100  Metabolic pathways
bub01110  Biosynthesis of secondary metabolites
bub01120  Microbial metabolism in diverse environments
bub01130  Biosynthesis of antibiotics
bub01200  Carbon metabolism
bub01212  Fatty acid metabolism
bub02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW23_3204
   00630 Glyoxylate and dicarboxylate metabolism
    BW23_3204
   00640 Propanoate metabolism
    BW23_3204
   00650 Butanoate metabolism
    BW23_3204
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW23_3204
   00072 Synthesis and degradation of ketone bodies
    BW23_3204
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW23_3204
   00310 Lysine degradation
    BW23_3204
   00380 Tryptophan metabolism
    BW23_3204
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BW23_3204
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BW23_3204
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BW23_3204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bub04147]
    BW23_3204
Enzymes [BR:bub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BW23_3204
Exosome [BR:bub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BW23_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJX17315
Position
I:3442982..3444172
Genome map
AA seq 396 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDVPPTELGAKVVREVLQRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAIDGGVAQHAPALTVNRLCGSGLQAIVSAAQGVLLGDADIAVAGGAENM
SRAPYSMQAARFGQRMGDMRVVDMMVGALNDPFQSIHMGVTAENVAAKYGISRDEQDALA
LESHRRASHAAQAGYFKDQILPVELIGSKKGTPVMFDRDEHVRHDASADDFTKLRPVFVK
ENGTVTAGNASGINDAAAAVLLMERRVAEQRGARPLARLVAYAHAGVDPAYMGIGPVPAT
RKVLERAGLTVADLDVIEANEAFAAQACAVTKALGLDPAKVNPNGSGISLGHPIGATGAL
IAVKALYELQRIGGRYALVTMCIGGGQGIAAIFERI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgaagtggtggtggtgagcggcgtgcggaccgcgatcggtgatttcggcggc
agcctgaaggatgtcccgccgaccgagctgggcgcgaaggtcgtgcgcgaagtgctgcag
cgcgcgcaggtgtcgggcgacgaggtcggccacgtggtgttcggcaacgtcgtgcatacc
gagccgaaggacatgtacctcgcgcgggtcgccgcgatcgacggcggcgtcgcgcagcac
gcacccgcgctcaccgtcaaccggctgtgcggctcgggcctgcaggcgatcgtgtcggcc
gcacagggcgtgctgctcggtgatgcggacatcgcggtcgccggcggcgcggaaaacatg
agccgcgcgccgtattcgatgcaggccgcgcggttcggccagcggatgggcgacatgcgc
gtcgtcgacatgatggtcggcgcgctgaacgatccgttccagtcgatccacatgggcgtg
acggcggagaacgtcgcggcgaaatacgggatctcgcgcgacgagcaggacgcgctggcg
ctcgaatcgcaccggcgcgcgtcgcatgcggcgcaggccggctatttcaaggaccagatc
ctgccggtcgagctgatcgggtcgaagaagggcacgccggtcatgttcgaccgcgacgag
cacgtgcggcacgacgcgagcgccgatgacttcacgaagctgcgcccggtgttcgtcaag
gaaaacggcacggtgacggccggcaatgcgtcgggcatcaacgatgcggccgccgcggtg
ctgctgatggagcgccgcgtggccgagcagcgcggcgcgcggccgctcgcgcgtctcgtc
gcgtatgcgcacgcaggcgtcgatcccgcatacatgggaatcggcccggtgccggcgacg
cgcaaggtgctcgagcgcgcagggctgacggtcgcggatctcgacgtgatcgaggcaaac
gaggcattcgccgcgcaggcctgcgcggtgacgaaggcgctggggctggacccggcgaag
gtgaatccgaacgggtcgggcatttcgctcggtcacccgatcggcgcgacgggcgcgttg
attgccgtgaaggcgctgtacgaactgcagcgcatcggcggccgttacgcgctcgtgacg
atgtgtatcggcggcgggcagggcatcgccgcgattttcgagcggatctga

DBGET integrated database retrieval system