KEGG   Burkholderia ubonensis: BW23_681Help
Entry
BW23_681          CDS       T03794                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bub  Burkholderia ubonensis
Pathway
bub00540  Lipopolysaccharide biosynthesis
bub01100  Metabolic pathways
Module
bub_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bub00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BW23_681 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bub01005]
    BW23_681 (rfaD)
Enzymes [BR:bub01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BW23_681 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bub01005]
 Unusual sugar
  BW23_681 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: AJX17809
Position
I:complement(743380..744372)
Genome map
AA seq 330 aa AA seqDB search
MTLIVTGAAGFIGANLVKALNERGETRIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVER
FARGDFGKVRAVFHEGACSDTMEHDGRYMMDNNFRYSRAVLDACLAQGAQFLYASSAATY
GGSTRFVEEREVEAPLNVYGYSKFLFDQVVRRVLPSAKSQIAGFRYFNVYGPRETHKGRM
ASVAFHNFNQFRAEGKVKLFGEYNGYAPGEQTRDFVSVEDVAKVNLFFFDHPEKSGIFNL
GTGRAQPFNDVATSVVNTLRALDNLPPLTLAQQVEQGLIEYVPFPDALRGKYQCYTQADQ
TKLRAAGYDAPFLTVQEGVDRYVRWLSGQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcatcgtcaccggcgcagccggtttcatcggcgcgaatctcgtcaaggcgctt
aacgagcgcggcgaaacgcgcatcatcgcggtcgacaatctgacgcgcgccgacaagttc
cggaacctcgtcgattgcgagatcgacgactatctcgacaagaccgaattcgtcgagcgc
ttcgcgcgcggcgatttcggcaaggtgcgcgcggtgttccacgaaggcgcgtgttccgac
acgatggaacacgacggccgctacatgatggacaacaacttccgctacagccgcgcggtg
ctcgacgcgtgcctcgcacagggcgcgcagttcctgtacgcgtcgtcggcggcgacctat
ggcggctcgacgcgcttcgtcgaggagcgcgaggtcgaggcgccgctcaacgtctacggc
tactcgaagttcctgttcgaccaggtggtccgccgcgtgctgccgagcgcgaagagccag
atcgccggcttccgctacttcaacgtgtacggcccgcgcgagacgcacaagggccgcatg
gcgtcggtcgcgttccacaacttcaaccagttccgcgcggaaggcaaggtcaagctgttc
ggcgaatacaacggctacgcgccgggcgagcagacgcgcgacttcgtgtcggtcgaggac
gtcgcgaaggtcaacctgttcttcttcgatcatccggagaagtcgggcatcttcaacctc
ggcacgggccgtgcacagccgttcaacgacgtcgcgacgtcggtggtcaacacgctgcgt
gcgctcgacaacctgccgccgctgacgcttgcgcagcaggtcgagcagggcctgatcgaa
tacgtgccgttcccggacgcgctgcgcggcaagtaccagtgctacacgcaggcggaccag
acgaagctgcgcgcggccggctacgatgcgccgttcctgacggtgcaggaaggcgtcgac
cgctacgtacgttggctgtccggccaggtttaa

DBGET integrated database retrieval system