KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU046Help
Entry
BU046             CDS       T00036                                 

Gene name
metF
Definition
(RefSeq) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc00670  One carbon pool by folate
buc01100  Metabolic pathways
buc01120  Microbial metabolism in diverse environments
buc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BU046 (metF)
Enzymes [BR:buc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BU046 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR DUF4252
Motif
Other DBs
NCBI-GeneID: 1109550
NCBI-ProteinID: NP_239883
UniProt: P57154
Position
50166..51044
Genome map
AA seq 292 aa AA seqDB search
MKNYSQYHQDIMNQKLENIRNNIQCSFEFFPPKNSFLEENLWSTVNRLSLLKPKFFSVTY
GANTGEREKTYDTVQKIYKKTGIITAAHLTCIDSTPHKLKEIAYNYWNSGIKSIVALRGD
TLEKDYRHTMYAVDLVLLLKKIADFDISVAAYPELHPESKNVKSDILNLKKKVDAGASRA
ITQFFFNIESYLRFRDNCIKNKINIDIIPGILPVCNFQKLKRFSSMTNVKIPKWMLDMFN
GLDDDIFTQKIIGSSIAIDMVKKLSCEGVKNFHFYTLNQSDITYSICHILGL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattattctcagtatcatcaagatataatgaatcaaaaattagaaaacattcgc
aataatatacagtgttcttttgaattttttccgccgaaaaattcttttttagaagaaaat
ttatggtctacagttaaccgtctttccttattaaaaccaaaatttttttctgtaacttat
ggcgcaaatactggtgaacgtgaaaaaacatatgatactgtacagaagatatataaaaaa
acaggtattattacagcggctcatttaacttgtattgattccacacctcataaattaaaa
gaaatagcatacaattattggaatagcggaattaaaagtattgtagcacttagaggagat
acattagaaaaagattataggcatactatgtatgcagtagatttagttcttttattaaaa
aaaatagctgactttgacatttccgtagccgcttatcctgaattacatcctgaatcaaaa
aacgttaaatcagatatactgaatttaaagaaaaaagttgatgcaggtgcgagcagagca
attactcagttcttttttaatattgaaagttatttgcgttttcgagataattgtattaaa
aataaaataaatattgatattataccaggtattttaccggtatgtaattttcagaaatta
aaacgtttttcaagtatgactaatgttaaaattccaaaatggatgcttgatatgtttaat
ggtttagatgatgatatattcacacagaaaataattggttctagtatagctatagatatg
gtaaaaaaattatcttgtgaaggagtaaaaaattttcatttttacactttaaatcagtct
gatattacttattctatttgtcatatcttaggtctataa

DBGET integrated database retrieval system