KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU238Help
Entry
BU238             CDS       T00036                                 

Gene name
dnaE
Definition
(RefSeq) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc03030  DNA replication
buc03430  Mismatch repair
buc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:buc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BU238 (dnaE)
   03430 Mismatch repair
    BU238 (dnaE)
   03440 Homologous recombination
    BU238 (dnaE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:buc03032]
    BU238 (dnaE)
   03400 DNA repair and recombination proteins [BR:buc03400]
    BU238 (dnaE)
Enzymes [BR:buc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BU238 (dnaE)
DNA replication proteins [BR:buc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BU238 (dnaE)
DNA repair and recombination proteins [BR:buc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     BU238 (dnaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon DUF655
Motif
Other DBs
NCBI-GeneID: 1109681
NCBI-ProteinID: NP_240067
UniProt: P57332
Position
262859..266344
Genome map
AA seq 1161 aa AA seqDB search
MNEPKFIHLHVHSDYSMIDGLSKPEDLVKKAASLNMPAIAITDYNNLYGVIKFYNMAHKL
GLKPIIGITVNFFSDLINNQLTKLTLLASTQEGYKNLILLISRAYQKGYVHNNHVTIEKK
WFSEINKGLILLSGGPQGELGKVLLNGQSSLISICLSFYQKYFPDSYYLELFRTNRDNEE
TYLHLAVDLSLSTGVPIVATNDVCFLSQEDFKIHKIRIAINEGEILQHSKIQNNYSNQQF
LKTTEEMSDLFSDIPEALINSVEIAKRCNVFIHSGKYFLPQFRTGKISVEKYLIKEAYKG
IKKRLNSRYLDIEKYKDIYSQYINRLDMELTVINKMGFPGYFLIVMEFIQWAKDNNIPVG
PGRGSGAGSLVAYALNITEVDPLSFNLLFERFLNPERISMPDFDIDFCMEKRDQVIDHVS
EIYGKNAVAQIITFGTLTAKAVIRDVGRVLGYPYGFINKLSKLVPLDPGITLKEAFSKES
ELFNLYKNNEDVKNLIDIAKKLEGTNRNIGKHAGGVVISPTKITDFCPLYCDEKGNNPVT
QFDKNDIEYIGLVKFDFLGLRTLTIISYAVEMINTKLNLNKKRTININSIPLDDAKCFKL
LKNSETTGVFQLESYGMKDLIKRLQPDCFEDMIALVALFRPGPLQSGMVDNFINRKHGRE
NISYPDHKWQHILLKPILESTYGIILYQEQVMEIAQVLSGYTLGSADILRRAMSKKNLKD
MSEQRAIFEEGASNNGIDKKLSIKIFDLLEKFAGYGFNKSHSVAYALVSYQTLWLKSHYP
AEFIAAAMTSDIDNTEKIVILINESLNMGVKIIPPNINLSKYEFYVNDQGDIVYGLGAIK
GIGKNSVQVLIKEREENKFFHDLFDLCMRIDSQKITRRVLEKLIMSGSCDCFDKNRNYLL
QSIDDAINASKESFRIKSFKQDSLFGIFQNELNQVKKNNLVNLVCPEKNKLQNEYQVLGF
YLTGHPINQYKKELECYVNGVKLSQLKFIKRNKKILVAGIIVSIKIKITKNKNRIAILVL
DDNTSRLEVVIFTELLNAYESLVKLNKLLFVHGMLNVSFIDKNIKMTAYALIDLSVLRKK
YINKLIIILNKEKTNIFFLNNLYECLDKQSKGNIPVFIFFDNKEVCLNKKLNKKWFVVIT
DDFLNKLKFLVGSKNIELKFN
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaccaaaatttattcatcttcatgtacatagtgattactcaatgattgatgga
ttatcaaaacctgaagatttagttaaaaaagcagcatctttaaatatgccggctatagct
ataactgattacaataatttatatggtgtaattaaattttataatatggctcataaacta
ggtttaaaacctattattggtattacagtaaattttttttctgatttgataaataatcaa
ttaacaaaattaactttattagcctccactcaggaaggatataaaaatttaattttatta
atttctcgtgcatatcaaaagggatatgttcataataatcatgttactattgaaaaaaaa
tggttttcagaaattaacaaaggattaatattactttctggtggccctcagggtgaactt
ggaaaagttttgcttaatggtcaatcatcattgatatctatttgtttgtcattttatcaa
aagtattttccggattcttactatttagaattatttcgtacaaaccgagataatgaagag
acatatttacatttagctgtagatttatctttatctacaggagttcctattgttgctact
aatgatgtttgttttttaagtcaagaagattttaaaattcataaaattagaattgctatc
aatgaaggtgaaatattacaacattctaaaattcaaaataattatagcaaccagcaattt
ttaaaaactacggaagaaatgtctgatcttttttcagatattccagaagcacttataaat
agtgtagaaattgcaaaacgctgcaatgtatttatacattccggaaaatattttttacct
cagtttcgaactggaaaaataagtgttgaaaaatatttaattaaagaagcttataaaggt
ataaaaaaaagattaaactcaagatatctagatattgaaaaatataaagatatttacagt
cagtatatcaaccgtttagatatggaattaactgtaattaacaaaatgggttttcctgga
tattttttaattgttatggaatttatacaatgggcaaaagataataatataccagtagga
ccaggacgaggttctggtgcaggttctcttgtagcatatgctttaaatatcacagaagta
gatccattatcttttaatcttttatttgaaaggtttttaaatccagaacgtatttctatg
cctgattttgatattgatttttgtatggaaaaacgtgatcaagtaattgatcatgtttca
gagatatatggtaaaaatgcagtagcacaaattattacctttggaacattaactgcaaaa
gctgttattagagatgtaggtcgagttttaggatatccatatggatttattaataaacta
tctaagttagtacctttagatcccgggataactttaaaagaagctttttccaaggaatct
gaattattcaatttatataaaaataatgaagatgttaaaaatttaattgatattgctaaa
aaattagagggtacaaatagaaatattggcaaacacgcagggggagtggttatttcacct
actaaaattactgatttttgtccattatactgtgatgaaaagggaaataatccagtaact
caatttgataaaaatgatatagaatatataggattagtaaaatttgattttcttggttta
cgcacactaactattattagctatgcggtagaaatgattaatacaaaattaaatctgaat
aaaaaaagaacaataaatattaattcaattcctcttgatgacgctaaatgttttaaatta
ttaaaaaattctgaaactactggtgtgtttcaattagaatcttatgggatgaaagattta
attaaaagattacaacctgattgttttgaagacatgatcgctttggttgcactttttaga
ccaggtcctctacaatctggaatggtcgataattttattaatcgaaaacatggacgtgag
aacatttcatatcccgatcataaatggcaacatatattattaaaacctatattagaatca
acatatggaattatattataccaagaacaagtaatggaaatagctcaagttttgtcaggt
tatacattaggtagtgcagacattttaagacgagctatgagcaagaaaaatttaaaagat
atgtcagaacaacgtgctatatttgaagaaggagcctcaaataatggtatcgataaaaaa
ttatctataaaaatttttgatttactagaaaaatttgcaggatatggatttaataaatct
cattctgtagcttatgctctagtttcctatcaaactttatggttgaaatcacattatcct
gcggaatttatagctgcagctatgacatctgatatagataatacagaaaaaattgttatt
ttaattaatgaatctctaaatatgggggtaaaaattatccctccaaacattaatttaagt
aaatatgaattttatgtaaatgatcaaggtgatatagtttatggtcttggtgctatcaag
ggtataggcaaaaattcagtgcaagttcttattaaagaacgtgaagaaaataaatttttt
catgacttatttgatctttgtatgcgaattgattctcaaaagataacccgtagagtttta
gaaaaattaattatgtctggtagttgtgattgttttgataaaaatagaaattatttactt
caatcaattgatgatgctataaatgcgtcaaaagaatcttttagaataaagtcttttaaa
caagatagtctttttggtatttttcaaaatgagttaaatcaagtaaaaaaaaataatctt
gttaatttagtctgccctgaaaaaaataaattacaaaacgaatatcaagtattgggattt
tatcttacaggacatcctatcaatcaatataagaaagaattagaatgttatgtaaatggt
gtaaaattatcacagttaaaattcatcaaaagaaacaagaaaattttagtagcaggaata
attgtttctatcaaaataaaaataacaaaaaataagaatcgtatagctattttggtattg
gacgataatactagccgtttagaagttgtgatttttacagaattattaaatgcatatgag
tctcttgtaaaattaaacaaactattgtttgttcacggtatgttaaatgtcagtttcatt
gataaaaatattaaaatgacggcctatgcacttatagatttaagtgttttgagaaaaaaa
tacataaataaactaataattatattaaataaagagaaaacaaacatattttttttaaat
aatttatacgaatgtttagataaacaatctaaaggtaatattcctgtttttatttttttc
gataataaagaagtatgtttaaataaaaaattaaataaaaaatggtttgttgtaattact
gatgattttttaaataaattaaaatttttagtaggatctaaaaacatagaattaaaattt
aattaa

DBGET integrated database retrieval system