KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU281
Entry
BU281             CDS       T00036                                 
Symbol
yedA
Name
(GenBank) hypothetical protein
  KO
K07790  putative membrane protein PagO
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:buc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BU281 (yedA)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-ProteinID: BAB12991
UniProt: P57368
Position
306569..307492
AA seq 307 aa
MNKILVIILFSLVSLTWGTTWIAMKIATETIPPFFATGMRFLVASPILIILAYFTKTPLL
FPYGQRWFQLIISIFYFSIPFALMLYGGMYVSSSVASIIFSSMPVAVLTVSFLYLKKKLF
LTQKIGMFISLITLLTILLIELESQCFFQWKGILALLFALFSHAFIYSECQKKCLNVSVI
TFNALPSLLSGILLSTTSWFIESPHINTFSNRSILAIFYLGDFSGIFGILSYFYLQQKVS
AFYASTVFLIFPVIAGFLENYIYKNAILLCEIWFIFPLIIGILLTLIPVNYLKKIRNKIT
RLSCLLF
NT seq 924 nt   +upstreamnt  +downstreamnt
atgaataaaatattagtgataatattattttctttagtttctcttacttgggggaccaca
tggattgcaatgaaaattgcaacagaaacaattcctcctttttttgctactggaatgcgt
tttttagttgcatctcctatattaattattttagcgtattttacaaaaaccccactctta
tttccatacggacagagatggtttcaattaatcatttcaattttttatttttctattcca
tttgcattaatgttatatggaggtatgtatgttagctcttctgtagcttctattatattt
tccagtatgcctgtagctgtattaacagtatcatttttatacttgaaaaaaaaattattt
ctaactcaaaaaataggcatgtttatttctttaataacattgttaactattttgctaata
gaattagaatcacaatgtttttttcagtggaagggaattttagctttactgtttgcttta
tttagccatgcttttatttactctgaatgtcaaaaaaaatgtttaaacgtatctgttata
acttttaatgctttaccatcattattatctggaatattgttatctactacatcttggttt
atagaaagtcctcatattaatactttttctaatagatctattttagcgatattttatctt
ggagatttttctggtatttttggtattttatcttatttttatttacaacaaaaagttagt
gcattttacgcttctactgtttttttaatttttccagtgattgctggatttttagaaaat
tatatttataaaaatgctattttattatgtgaaatatggtttattttcccattaattatt
ggaatattattaactttaatccccgttaattatctaaaaaagataagaaataaaataacg
agactatcatgtttgctattttag

DBGET integrated database retrieval system