KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU283Help
Entry
BU283             CDS       T00036                                 

Gene name
sohB
Definition
(RefSeq) periplasmic protease
  KO
K04774  serine protease SohB [EC:3.4.21.-]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:buc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:buc01002]
    BU283 (sohB)
Enzymes [BR:buc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BU283 (sohB)
Peptidases [BR:buc01002]
 Serine Peptidases
  Family S49: protease IV family
   BU283 (sohB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S49_N Peptidase_S49 SDH_sah MscL
Motif
Other DBs
NCBI-GeneID: 1109982
NCBI-ProteinID: NP_240107
UniProt: P57370
Position
308348..309358
Genome map
AA seq 336 aa AA seqDB search
MNLLLNYELFLAKIITFIIISISILILFYTIIKRKKNIQSKIKITLLQDNYKNVKNKILL
STMKNVEKKIWFKKQKEKNKKELLLKNNKKKLFVLDFKGDVYANEVVGLREEISAILLVA
NKHDEVLLRLESSGGVIHGYGLAASQLNRLRQKGIRLIVSVDKIAASGGYMMACVADYIV
SAPFAIIGSIGVVGQIPNFNKLLKKCNIDFELHTAGDYKRTLTMFGNNTESTRKKFCDEL
NTTHKLFKSFIKEMRPSLDIEDVSNGEHWFGTIALEKKLVDQIGTSDDILISKMEEYTLL
RIQYIYRKKILERFTASVTHNLSETLLKIFFYKNYL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttacttttaaattatgaattattcttagcaaaaattattacttttattataatt
agtatttccatattaattttgttttatactataataaaaagaaaaaaaaatattcaaagt
aaaatcaagattactttattacaagataattataaaaatgtaaaaaataaaattttatta
tctacaatgaaaaatgttgaaaaaaaaatatggtttaaaaaacaaaaagaaaaaaataaa
aaggaactattacttaaaaataacaagaaaaaattgtttgtattagattttaaaggcgat
gtttatgcaaacgaagttgttggattgagagaagaaatatctgctattcttttagtagca
aacaaacatgatgaagtattattgagactagaaagctcgggaggtgtaattcatggatac
ggcctagcagcatctcagttaaatagattacgtcaaaaaggaatacgtttaattgtttct
gtagataaaattgcagcaagtggaggatatatgatggcatgtgttgcagattatattgtt
tcagcgccatttgcgataataggttcgattggagtagtcggtcaaatacctaatttcaat
aagttattaaaaaaatgtaatatagattttgaacttcatacagctggagattataaacgt
actttaacaatgtttggaaacaatactgaatctacacgtaagaaattctgtgatgagtta
aatacaacacataaactttttaagagttttattaaagaaatgaggccatctctagatatt
gaagacgtttctaatggagaacactggtttggaactattgctttagaaaaaaaattagta
gaccaaattgggacaagtgatgatatcttaatatctaaaatggaagaatacactttgtta
agaattcaatatatttatagaaaaaaaatattagaacgttttactgcttcagtaacacat
aatctcagtgaaacgttactaaaaatatttttttataaaaattatttatag

DBGET integrated database retrieval system