KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU368Help
Entry
BU368             CDS       T00036                                 

Gene name
argF
Definition
(RefSeq) ornithine carbamoyltransferase subunit I
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc00220  Arginine biosynthesis
buc01100  Metabolic pathways
buc01110  Biosynthesis of secondary metabolites
buc01130  Biosynthesis of antibiotics
buc01230  Biosynthesis of amino acids
Module
buc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:buc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BU368 (argF)
Enzymes [BR:buc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BU368 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 1109722
NCBI-ProteinID: NP_240186
UniProt: P57449
Position
406304..407320
Genome map
AA seq 338 aa AA seqDB search
MNNLYQRDCLRLLDFTSLELQNIITLAQKLKQYKKNNKEIQLLKKKNIALIFEKESTRTR
CSFEVAAFDQGAHVTYLGPGSTHLGTKESIEDTAKILGRLYDGIQYRGHHHSTIEILAKN
SKVPVWNGLTEKFHPTQLLADLLTIKEIFPERKFYEIKCAYVGDAHNNMGNSLLEAASLV
GLDLRLVAPKECWPEKNIFKFCKEQMKNKKGNIICTENINEGVKNVDFIYTDVWVSMGES
QEVWKKRIELLSSYQVNSLMLKITNNPQVKVLHCLPALHDQKTCTVKSILKKYGFKNGME
ITDEVFQKNQKIIFEQAENRLHTIKAILVSSLLKTIKF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctttatcaacgtgattgtttaagactattagattttacttctttagaatta
caaaatataattacactggctcaaaagctaaaacaatataaaaaaaacaataaagaaatt
caactactcaaaaaaaaaaatattgctttaatttttgaaaaagaatccactcgtacaaga
tgctcatttgaagtagctgcatttgatcaaggagctcatgtcacgtatcttggacctggt
agtacacatcttggaacaaaagagtctatagaagatactgctaaaatactcggacgttta
tatgacggtattcaatatcgaggacaccatcatagtacaatagaaattttagctaaaaat
tcaaaagtgccagtttggaatggtttgactgaaaaatttcaccctacacaattgcttgct
gatttactaactataaaagaaatttttccagaaagaaaattttatgaaataaaatgtgct
tatgttggagatgcacataataatatgggcaatagtttattagaagctgcgtcattagtt
ggattagatttacgtttagtagctcctaaagaatgttggcccgaaaaaaatatatttaaa
ttttgtaaagaacaaatgaaaaataaaaaagggaatataatatgtactgaaaacattaac
gaaggagtaaaaaatgtagattttatatacactgatgtctgggtatctatgggagaatct
caagaagtatggaaaaaaagaattgaattattgagctcttatcaagtaaatagtttaatg
ttaaaaataactaataatccacaagtaaaagtattgcattgccttcctgctttacatgat
caaaaaacttgtacagttaaatctatattaaaaaaatatggttttaaaaatggaatggaa
ataacagatgaagtttttcaaaaaaaccaaaaaattattttcgaacaagcagaaaataga
ttgcatactattaaagctattcttgtatctagtttattaaaaactattaaattttaa

DBGET integrated database retrieval system