KEGG   Burkholderia sp. Bp5365: AQ610_00100Help
Entry
AQ610_00100       CDS       T04266                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00071  Fatty acid degradation
bud00072  Synthesis and degradation of ketone bodies
bud00280  Valine, leucine and isoleucine degradation
bud00310  Lysine degradation
bud00362  Benzoate degradation
bud00380  Tryptophan metabolism
bud00620  Pyruvate metabolism
bud00630  Glyoxylate and dicarboxylate metabolism
bud00640  Propanoate metabolism
bud00650  Butanoate metabolism
bud00900  Terpenoid backbone biosynthesis
bud01100  Metabolic pathways
bud01110  Biosynthesis of secondary metabolites
bud01120  Microbial metabolism in diverse environments
bud01130  Biosynthesis of antibiotics
bud01200  Carbon metabolism
bud01212  Fatty acid metabolism
bud02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AQ610_00100
   00630 Glyoxylate and dicarboxylate metabolism
    AQ610_00100
   00640 Propanoate metabolism
    AQ610_00100
   00650 Butanoate metabolism
    AQ610_00100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AQ610_00100
   00072 Synthesis and degradation of ketone bodies
    AQ610_00100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AQ610_00100
   00310 Lysine degradation
    AQ610_00100
   00380 Tryptophan metabolism
    AQ610_00100
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AQ610_00100
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AQ610_00100
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AQ610_00100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bud04147]
    AQ610_00100
Enzymes [BR:bud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AQ610_00100
Exosome [BR:bud04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AQ610_00100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALX40980
Position
1:complement(20238..21443)
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTSAVDDVVLGCVEPV
GEQGACIGRIAVLAAGYAQTTAGVQVNRFCASGLEACNMAAAQVMSGQSDMAIGGGVESM
SRVPMGASGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAYAAT
QAGWFARSIVPVRDVNGLTILDRDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARVRSFASIGSEPSIMLTG
PAYAAEKALKRAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgat
cgcaacggtctcgacacgagcgccgtcgatgacgtcgtgctcggctgcgtcgagcccgtc
ggcgagcagggcgcgtgcatcggccgcatcgcggtgctcgcggcgggttacgcgcagacg
acggccggcgtgcaggtcaaccgcttctgcgcgtcgggcctcgaagcgtgcaacatggcg
gccgcgcaggtgatgtccggccagtcggacatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggcgcgagcggcggcgcatggcccgtcgatccggccatcgcgatt
ccgagctacttcgtgccgcagggcgtatcggccgacacgatcgcgacgaagtggggctac
agccgcgccgacgtcgacgcatacgccgccgagagccaccgccgcgcatacgcggcgacg
caggccggctggttcgcgcgctcgatcgtgccggtgcgcgacgtcaacggcctgacgatc
ctcgatcgcgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccttcgttcgccgagctgggcgagatgtacggcttcgacgcggtgatccgccagcgctac
ccggagctcgaacgcatcgagcacgtgcatcacgcgggcaacagctcggggatcgtcgac
ggcgcgtcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgggtccgctcgttcgcgagcatcggctcggagccgtcgatcatgctgacgggg
ccggcctatgcggccgagaaggcgctcaagcgcgccggcatgcgcgcggccgacatcgac
ctgtacgagctgaacgaagcgttcgcgtcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgaccggatcaacgtgaacggcggcgcgatcgcgatgggccatccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgagctggagcggcgcggcgcggcc
acgggcctcgccaccttgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system