KEGG   Burkholderia sp. Bp5365: AQ610_06315Help
Entry
AQ610_06315       CDS       T04266                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bud00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AQ610_06315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bud02000]
    AQ610_06315
Enzymes [BR:bud01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AQ610_06315
Transporters [BR:bud02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AQ610_06315
   Histidine transporter
    AQ610_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_13 AAA_29 AAA_16 AAA_33 APS_kinase DUF87 PRK G-alpha FtsK_SpoIIIE AAA_23 AAA_22 AAA_28
Motif
Other DBs
NCBI-ProteinID: ALX42076
Position
1:1366300..1367094
Genome map
AA seq 264 aa AA seqDB search
MAETTTTNAACKLEARDIHKRYGDNEVLKGVSLNAKAGDVISVIGASGSGKSTFLRCINF
LERPNAGQIVVDGETVRTKTDRAGNLEVADHKQLQRIRTKLAMVFQHFNLWSHMNVLENV
MEAPVHVLGISRREAEGRAREYLEKVGLAPRVEKQYPSHLSGGQQQRVAIARALAMHPDV
MLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEE
GAPAEVFGGTKSERLKQFLSGSLK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttggcagagaccacgaccacgaatgccgcgtgcaagctcgaggcacgggacatccacaag
cgctacggcgacaacgaggtgctcaagggcgtgtcgctgaacgcgaaggcgggcgacgtg
atcagcgtgatcggcgcgtccggctcgggcaagagcacgttcctgcgctgcatcaacttc
ctcgagcggccgaacgcgggtcagatcgtcgtcgacggcgagacggtgcgcacgaagacc
gatcgcgcgggcaatctcgaagtcgccgatcacaagcaactgcagcggattcgcacgaag
ctcgcgatggtgttccagcacttcaatctgtggtcgcacatgaacgtgctggagaacgtg
atggaagcgcccgtgcacgtgctggggatttcgaggcgggaggcggaggggcgcgcgcgc
gaatatctggagaaggtcggtctcgcgccgcgggtggagaagcagtatccgtcgcatttg
tcgggcggccagcagcagcgcgtcgcgattgcgcgtgcgctggcgatgcacccggacgtg
atgctgttcgacgagccgacgtcggcgctcgatccggagctggtcggcgaagtgctgaag
gtgatgcagaagctcgcggaggaagggcggacgatgatcgtcgtcacgcacgagatgggc
tttgcgcgcaacgtgtcgaatcacgtgatgttcctgcaccagggtcgcgtcgaggaggag
ggcgcgcctgccgaggtgttcggcggcacgaagagcgagcgcctgaagcagttcctgtcg
ggcagcctcaagtaa

DBGET integrated database retrieval system