KEGG   Burkholderia sp. Bp5365: AQ610_12635Help
Entry
AQ610_12635       CDS       T04266                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00360  Phenylalanine metabolism
bud00362  Benzoate degradation
bud00621  Dioxin degradation
bud00622  Xylene degradation
bud01100  Metabolic pathways
bud01120  Microbial metabolism in diverse environments
bud01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AQ610_12635
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AQ610_12635
   00622 Xylene degradation
    AQ610_12635
   00621 Dioxin degradation
    AQ610_12635
Enzymes [BR:bud01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AQ610_12635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: ALX43160
Position
1:complement(2842381..2843391)
Genome map
AA seq 336 aa AA seqDB search
MDKKLYISDVTLRDGSHAIRHQYSVEQAKVIAKALDEAKVDSIEVAHGDGLQGGSFNYGF
GAHTDVEWIEAVASVVTHAKIATLLLPGIGTVHDLKAAYNAGARIVRIATHCTEADISRQ
HIEYARELGMEAVGFLMMSHMLAPRALAEQAKLMESYGATCCYVVDSGGAMNMNDIRDRM
RAFKDVLKSGTETGIHAHHNLSLGVANSIVAVEEGCDRVDASLAGMGAGAGNAPLEVFVA
AASRLGWNHGCDLYRLMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEMAAKK
YGIKAVDILVELGRRRMVGGQEDMIVDVALDLLKTR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaaactctacatctccgacgtgacattgcgggacggaagtcacgcaattcgc
caccaatacagcgttgagcaggcaaaggtaatcgcgaaagcgctcgacgaggccaaggtt
gactcaatcgaagttgcacacggtgatggtctgcaaggaggaagtttcaactatggcttc
ggcgcacatacggacgttgagtggatcgaggccgtcgccagcgtagtgacgcacgcgaag
attgctacgttgttgctgcccggtatcggtaccgtccatgatttgaaggcggcatataac
gccggcgcacggatcgtccgcatagccacgcattgcacggaggccgatatctcaaggcag
catatcgagtacgcgcgcgaactcggcatggaggcggtgggcttcttgatgatgagccac
atgctcgcgcctcgtgcgctggccgaacaagcaaagctgatggagagctacggcgcgacc
tgctgctacgtggtcgattccggcggtgcgatgaatatgaacgacatacgtgacaggatg
cgtgcgttcaaggatgtgctcaaatccggaaccgagacggggatacatgcgcaccataac
ctgagcttgggcgtggccaactcgatcgtggctgtcgaagagggttgcgatcgtgtcgat
gcgagtctcgcggggatgggcgccggcgccggcaatgcaccgctggaagtcttcgtcgca
gcggcgtcgcgcctcggttggaaccatggctgcgatctataccgtctgatggatgcggct
gacgatatcgttcgacctctccaggatcgccccgtgcgcgtcgatcgcgagacgcttgca
ttgggttacgcgggcgtttattcgagtttcctgcgccactcggaaatggccgcaaagaaa
tatggcatcaaagctgttgatattctcgttgaactcggtaggcgtcgcatggttgggggc
caggaggacatgatcgtcgatgtcgcgcttgatttgctgaagacgcgataa

DBGET integrated database retrieval system