KEGG   Burkholderia sp. Bp5365: AQ610_14205Help
Entry
AQ610_14205       CDS       T04266                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00860  Porphyrin and chlorophyll metabolism
bud01100  Metabolic pathways
Module
bud_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AQ610_14205
Enzymes [BR:bud01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AQ610_14205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ALX43439
Position
1:complement(3189896..3191521)
Genome map
AA seq 541 aa AA seqDB search
MRLSPFAARRASRDSFTMTANANANANANANANANANANANANANANAARARGALMIQGT
TSDAGKSTLVAGLCRLARRAGVSVAPFKPQNMALNSAVTADGGEIGRAQALQALAAGIDA
HTDLNPVLLKPTGDRGAQVIIHGKARANLTARAYHDYKPTAMRAVLESYGRLRGAYDAVI
VEGAGSPAEINLREGDIANMGFAEAVDCPVVLVADIDRGGVFAHLVGTLACLSDSERARV
RGFVINRFRGDPALLEPGLRWLEARTGKPVLGVLPYLHGLTLDAEDMLPASARTAAPRRD
ASVLRVVVPALPRISNHTDFDALRVHPRVDFAYWKSGPAPDADLLILPGSKNVLADLAWL
RDAGWDALVKRHLRYGGKVIGICGGMQMLGRTLDDPHGVEGVAGATSAGLGLLDYATTLT
PEKTLVNATGRLAFGGDARVSGYEIHMGRTEGPALASPALALAGPDGERPDGAVSADGQI
LATYLHGLFDTPQACSALLEWAGLGGAEPVDYPALREASLERLADTLAEHLDLDRVFAAF
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcggctttcgccatttgccgcgcgccgcgcgtcgcgcgattcgttcacgatgactgcc
aacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgcc
aacgccaacgccaacgccaacgccgcccgtgcgcgcggcgcgctgatgattcagggcacg
acgtccgacgcgggcaagagcacgctcgtcgcgggcttgtgccggctcgcgcgccgcgcg
ggcgtaagcgtcgcgccgttcaagccgcagaacatggcgctcaacagcgcggtgacggcg
gacggcggcgagatcggccgcgcgcaggcgctgcaggcgctcgcggccggcatcgatgcg
cacaccgacctgaatccggtgctgctgaagccgacgggcgatcgcggcgcgcaggtgatc
atccacggcaaggcgcgcgcgaacctgaccgcgcgcgcctatcacgactacaagccgacc
gcgatgcgggcggtgctcgaatcctacggccggctgcgcggcgcgtacgacgcggtgatc
gtcgaaggcgcgggcagtcccgccgagatcaacttgcgcgaaggcgacatcgcgaacatg
ggattcgcggaagcggtcgactgcccggtcgtgctcgtcgccgacatcgaccgaggcggc
gtgttcgcgcatctcgtcggcacgctcgcgtgcctgtcggacagcgagcgcgcgcgcgtg
cgcggcttcgtgatcaaccgctttcgcggcgatcccgcgctgctcgagccggggctgcgc
tggctcgaggcgcggaccggcaagcccgtgctcggcgtgctgccctatttgcacggcctc
acgctcgatgcggaggacatgctgcccgcgagcgcgcgcacggcggcgccgcggcgcgac
gcgagcgtgctgcgggtggtcgtgcccgcgctgccgcgaatcagcaaccacaccgatttc
gacgcgctgcgcgtgcatccgcgcgtcgacttcgcgtactggaagagcgggcccgcgccc
gacgccgatctgctgatcctgcccggctcgaagaacgtgctcgccgatctcgcgtggctg
cgcgacgcgggctgggacgcgctggtcaagcgccatctgcgctacggcggcaaggtgatc
ggcatctgcggcggcatgcagatgctcggccgcacgctcgacgatccgcacggcgtcgag
ggcgtggcgggcgcgacgagcgcgggcctcggcctcctcgactatgcgacgacgctgacg
ccggagaagacgctcgtcaacgcgacggggcggctcgcgttcggtggcgatgcgcgcgtc
tccggctacgagatccacatggggcggacggaagggccggcgcttgcgtcgccagcgctc
gcgctcgcggggccggacggcgagcggccggacggcgcggtgtcggcggacgggcagatt
ctcgcgacctatcttcacgggctcttcgacacgccgcaggcgtgctcggcgctgctcgaa
tgggcggggctcggcggcgcggagccggtcgactatccggcgctgcgcgaggcgtcgctc
gagcggctggccgacacgctcgccgagcacctcgatctcgatcgcgtgtttgcggcgttc
gcgtga

DBGET integrated database retrieval system