KEGG   Burkholderia sp. Bp5365: AQ610_15855Help
Entry
AQ610_15855       CDS       T04266                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00903  Limonene and pinene degradation
bud00930  Caprolactam degradation
bud01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AQ610_15855
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AQ610_15855
Enzymes [BR:bud01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     AQ610_15855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: ALX43735
Position
1:complement(3563057..3564022)
Genome map
AA seq 321 aa AA seqDB search
MSWQSKVACWLLRRQFHPETQRPVIDPARARRLTKLRMRVPRRPPAGWRLRERYGAGDAP
LRGEWLERADAMPGRAQHSRMLLYFHGGGYYFCSPQTHRPLVFALTKHAGVRSFSLDYRL
APEHPFPAALNDALAAYRQLVSAGTPPESIVFGGDSAGGGLALAALVALRDAGDPLPAGA
VLFSPWTDLAATGDTLRSHDGLDPMFAGAALGRAARLYLGDTPGTHPHASPLYADFTGLP
PLFIQAGSTEVLLDDSRRVADKARAAGVHVELEIWPQMPHVWQIYVPFVPESARALERAA
AFVRRIAVERATQRTADASIA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcagagcaaagtggcgtgctggctgctgcgccggcagtttcatcccgagacg
cagcgtcccgtgatcgatccggcgcgtgcgcggcggctgacgaagctgcggatgcgcgtg
ccgcgccgtccgcccgccggctggcggctgcgcgagcgttacggcgccggcgacgcgccg
ctgcgcggcgaatggctcgagcgcgcggacgccatgccgggccgcgcgcagcacagccgg
atgctgctgtatttccacggcggcggttattacttctgctcgccgcagacgcatcgcccg
ctcgtgttcgcgctgacgaagcacgccggcgtgcgctcgttctcgctcgactatcggctc
gcgcccgagcatccgtttccggccgcgctgaacgacgcgctcgccgcgtaccggcaactc
gtgtccgccggcacgccgccggagtcgatcgtgttcggcggcgattcggcgggcggcggc
ctcgcgctcgcggcgctcgtcgcgctgcgcgacgcgggcgacccgctgcccgcgggcgcc
gtgctgttctcgccctggaccgatctcgccgcgacgggcgacacgctgcgctcgcacgac
gggctcgacccgatgttcgcgggcgcggcgctcggccgcgcggcgcgcctgtatctcggc
gacacgccgggcacgcatccgcatgcgtcgccgctgtacgcggatttcacgggattgccg
ccgctcttcatccaggcgggcagcaccgaggtgctgctcgacgattcgcggcgcgtcgcc
gacaaggcgcgcgcggcgggcgtgcacgtcgaactggagatatggccgcagatgccgcac
gtctggcagatctatgtgccgttcgtgcccgaatcggcgcgcgcgctcgagcgcgcggcc
gcgttcgtgcggcgcatcgcggtcgagcgcgcgactcagcgcacggcagacgcgtcgatc
gcctga

DBGET integrated database retrieval system