KEGG   Burkholderia sp. Bp5365: AQ610_16080Help
Entry
AQ610_16080       CDS       T04266                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00540  Lipopolysaccharide biosynthesis
bud01100  Metabolic pathways
Module
bud_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AQ610_16080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bud01005]
    AQ610_16080
Enzymes [BR:bud01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     AQ610_16080
Lipopolysaccharide biosynthesis proteins [BR:bud01005]
 Unusual sugar
  AQ610_16080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase Hydrolase_3 HAD_2 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ALX43777
Position
1:3620699..3621238
Genome map
AA seq 179 aa AA seqDB search
MSAPPATAAERASRVKLMIFDVDGVLTDGGLHFTAAGDTTKSFNTLDGHGVKLLGEAGIA
TAIITGRRSEAVAARAREMRIAHLHQGVENKLAVFGELLRTLGLEPAECGYMGDDWPDLA
VMLRCGFAAAPANAHPDVIARAHWVAEARGGHGAVREACDAILRAQRRYDALLAAACGA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgccccctgccacggcggccgaacgcgcgagccgcgtgaagctgatgattttc
gacgtcgacggcgtgctgaccgacggcggcctccatttcaccgcagcgggcgacacgacg
aagtcgttcaacacgctcgacggccacggcgtgaagctcctcggcgaagcgggcatcgcg
accgcgatcatcaccggccgccgctcggaagccgtcgccgcgcgcgcgcgggaaatgcgc
atcgcgcacctgcatcagggcgtcgagaacaagctcgccgtgttcggcgagctgctgcgc
acgctcggcctcgagcccgccgagtgcggctacatgggcgacgactggcccgacctcgcg
gtgatgctgcgttgcggcttcgcggccgcgccggcgaacgcgcatccggacgtgatcgcg
cgcgcgcactgggtcgccgaggcccgcggcggccacggcgcggtgcgcgaagcgtgcgac
gcgatcctgcgcgcgcagcgccgctacgacgcgctgctcgccgccgcctgcggagcctga

DBGET integrated database retrieval system