KEGG   Burkholderia sp. Bp5365: AQ610_21060Help
Entry
AQ610_21060       CDS       T04266                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00450  Selenocompound metabolism
bud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AQ610_21060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bud03016]
    AQ610_21060
Enzymes [BR:bud01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     AQ610_21060
Transfer RNA biogenesis [BR:bud03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    AQ610_21060
 Prokaryotic Type
    AQ610_21060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ALX45019
Position
2:399167..400231
Genome map
AA seq 354 aa AA seqDB search
MTETKQTDAAPPRLTSLSHGGGCGCKIAPGVLSELLRRNAPPALFPDLLVGTETSDDAAV
YRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINVLP
HETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAALGVVHPARVKRNAAARAGDVL
VLGKPLGVGVLSAALKKDRLDAQGYAQMIATTTKLNRPGTALAALPGVHALTDVTGFGLL
GHTLELARGAGLTARVRYGALPWLAGVEAFAADGVFTGASGRNWAAYGHDVRLGDGLPAV
AQALLTDPQTSGGLLVACAPDAVDEVLACFAGDGFDRAAVIGEMADGPARVDVS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccaagcaaaccgacgcggcgccgccgcgcctcacgagcctgtcgcacggc
ggcggctgcggctgcaagatcgcgcccggcgtgctgtcggagctgctcaggcgcaatgcg
ccgcccgcgctctttcccgatctgctcgtaggcaccgagacgtccgacgacgcggccgtc
taccgcctgaacgacgagcaggcgatcgtcgcgaccaccgatttcttcatgccgatcgtc
gacgatccgttcgacttcggccgcatcgccgcgacgaacgcgctgtccgacgtctacgcg
atgggcggcaagccgatcctcgcgctcgcgctcgtcggcatgccgatcaacgtgctgccg
cacgagacgatcgccgcggtgctgcgcggcggcgaggcggtgtgcgcggacgcgggcatc
ccggtggcgggcggccattcgatcgattcggtcgagccgatctacgggctcgcggcgctt
ggcgtcgtccatccggcgcgcgtgaagcgcaacgcggccgcgcgcgcgggcgacgtgctc
gtgctcggcaagccgctcggcgtcggcgtgctgtccgccgcgttgaagaaggaccggctc
gacgcgcaaggctacgcgcagatgatcgcgacgacaacgaagctcaatcggccgggcacg
gcgctcgccgcgctgcctggcgtgcatgcgctgaccgatgtgacgggcttcggcctgctc
ggccacaccctcgagcttgcgcgcggcgcggggctgaccgcgcgcgtgcgctacggcgcg
ctgccgtggctcgcgggcgtcgaggcgttcgcggccgacggcgtgttcaccggcgcgtcc
ggccgcaactgggccgcgtatggtcacgacgtgcgcctgggcgacggcctgcccgcggtc
gcgcaggcgctgctgaccgacccgcagacatcgggcgggctgctcgtcgcgtgcgcgccc
gacgcggtcgatgaagtgctcgcctgcttcgccggcgacggcttcgatcgcgcagcggtg
atcggcgaaatggccgacgggccggcgcgcgtcgacgtgagctga

DBGET integrated database retrieval system