KEGG   Burkholderia sp. Bp5365: AQ610_21735Help
Entry
AQ610_21735       CDS       T04266                                 

Definition
(GenBank) MBL fold metallo-hydrolase
  KO
K20257  2-aminobenzoylacetyl-CoA thioesterase [EC:3.1.2.32]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00405  Phenazine biosynthesis
bud01110  Biosynthesis of secondary metabolites
bud02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AQ610_21735
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AQ610_21735
Enzymes [BR:bud01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.32  2-aminobenzoylacetyl-CoA thioesterase
     AQ610_21735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 PDEase_II
Motif
Other DBs
NCBI-ProteinID: ALX45134
Position
2:545426..546322
Genome map
AA seq 298 aa AA seqDB search
MQHSTPGWIDSQLAIVGTEDVPLYVVVNDEAATLVEGGLSGMTELVWRQLHALLSDYGGI
RHLRYWLITHSHYDHCSLLGTLAPRMPWLHIVGSPDTADALQSPSACRTIRMLDAQASVA
WEPVAEAELADLSDIPLYPLNPGRALDIGEGMRMRAIALPGHSACLLGYHCPQLDLLFVS
DALGEYHAPTQWLPLVFQDLPAYRRSLDAIEQQHASRIALGHYGVVGGGVARHAVRHARD
GLAARSDEARAARGDTNATRALARQWTERYAARSAKVVPRALHLKSMERMIDLFQRAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacagcactccaggctggatcgactcgcagctcgccatcgtcggcaccgaggac
gtgccgctgtacgtggtcgtcaacgacgaagccgcgacgctcgtcgaaggcgggctgagc
ggcatgaccgagctcgtgtggcggcagcttcacgccctgctgagcgactacggcggcatc
cggcatctgcgctactggctgatcacgcattcgcactacgaccattgcagcctgctcggc
acgctcgcgccgcgcatgccgtggctgcacatcgtcggctcgcccgatacggccgacgcg
ctgcagagcccgtccgcgtgccgaacgatcaggatgctcgacgctcaggcgtccgtcgcg
tgggagccggtcgccgaggccgagctcgccgacctgtcggacattccgctgtatccgctc
aatccgggcagggcgctcgacatcggcgaagggatgcggatgcgcgcgatcgcgctgccg
ggccacagcgcatgcctgctcggctatcactgcccgcagctcgatctgctgttcgtgtcg
gacgccctcggcgaataccacgcgccgacgcaatggctgccgctcgtgttccaggatctg
cccgcctaccggcggtcgctcgacgcgatcgagcagcagcacgcgtcgcggatcgcgctc
ggccattacggcgtcgtcggcggcggcgtcgcgcggcacgcggtccggcatgcgcgcgac
ggtcttgccgcgcgcagcgacgaagcgcgcgccgcgcgcggcgacacgaatgcgacgcgc
gcgctcgcgcggcaatggaccgagcgctacgcggcgcgcagcgcgaaagtggtgccgcgc
gcgctgcatctgaagagcatggagcgaatgatcgacctgttccagcgcgccgcgtag

DBGET integrated database retrieval system