KEGG   Burkholderia sp. Bp5365: AQ610_29805Help
Entry
AQ610_29805       CDS       T04266                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bud  Burkholderia sp. Bp5365
Pathway
bud00361  Chlorocyclohexane and chlorobenzene degradation
bud00625  Chloroalkane and chloroalkene degradation
bud01100  Metabolic pathways
bud01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bud00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AQ610_29805
   00361 Chlorocyclohexane and chlorobenzene degradation
    AQ610_29805
Enzymes [BR:bud01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AQ610_29805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ALX46544
Position
2:complement(2476166..2476888)
Genome map
AA seq 240 aa AA seqDB search
MQALGVKALVFDVFGTVVDWRSGVIRDATPFLAKYGGAGADPAAFADAWRARYSPAMEHV
RSGRRPFTRLDVLHRENLEAILPAFGIDRAGVADADLDALNLAWHRLDPWPDSVAGLARL
KARYIIAPLSNGNVILMIDMAKRAGLPWDAILGAEVAQAYKPTPEAYLRTADILALRPDE
VCLVAAHNGDLAAARRCGYRTAFVARPREHGPAQTADLRAEQDWDVVAADFVELAERFGA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcttggcgtgaaggcattggtattcgacgtgttcggcaccgtggtcgactgg
cgttccggcgtcattcgcgacgcgacgccgtttcttgcgaagtacggcggcgcgggagcc
gatccggccgctttcgcggatgcgtggcgcgcgcgctattcgcccgcgatggagcacgtg
cgcagcggccgccggccgttcacgcggctcgacgtgctgcatcgggagaatctcgaagcg
atcctgcccgcgttcggcatcgatcgcgcgggcgtggccgacgccgatctcgacgcactg
aatctcgcgtggcaccggctcgatccgtggcccgattcggtcgcggggctcgcgcggctg
aaggcgcgctacatcatcgcgccgctgtcgaacggcaacgtgatcctgatgatcgacatg
gcgaagcgcgcgggattgccgtgggacgcgatcctcggcgccgaagtggcgcaggcgtac
aagccgacgcccgaggcgtacctgcgcacggccgacatcctcgcgctgcgtcccgacgag
gtgtgcctcgtcgccgcgcacaacggcgaccttgcggccgcgcggcgctgcggctatcgg
accgcgttcgtcgcgcgcccgcgcgagcacggtcccgcgcagacggcagatctgcgcgcg
gagcaggattgggacgtcgtcgcggcggatttcgtcgagctcgcggagcgcttcggcgcg
tga

DBGET integrated database retrieval system