KEGG   Burkholderia sp. Bp5365: AQ610_30310Help
Entry
AQ610_30310       CDS       T04266                                 

Definition
(GenBank) peptidase S53
  KO
K05999  xanthomonalisin [EC:3.4.21.101]
Organism
bud  Burkholderia sp. Bp5365
Brite
KEGG Orthology (KO) [BR:bud00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bud01002]
    AQ610_30310
Enzymes [BR:bud01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.101  xanthomonalisin
     AQ610_30310
Peptidases and inhibitors [BR:bud01002]
 Serine peptidases
  Family S53
   AQ610_30310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ
Motif
Other DBs
NCBI-ProteinID: ALX46633
Position
2:2586638..2588302
Genome map
AA seq 554 aa AA seqDB search
MQRTQHVNRLFSKRFALSLLPLAIAATLSPLVAHAAPDWAPTRTDAFLIARASAAAASQT
LAKTAPSYALNVIGTPELTDTNVTPLELSQPLHVTIVLKSRNEAQLDALVREVNQPGSAN
YRKYLTPEQFNARFAPTDDQVRAVVAHLKANGFGNITVSANNKLIFAQGNASNAERGFHT
TLKRFNYRGKAVYANDSAALVPASLSPFVESVLGLQSAAVPHRLIHRGTPADARIQTDTI
TKNATASGSQVGHQPTDFAQIYDASGLPAATSTTVGIITWGDMTQTIADLNTFTQNAGLP
TVNTAVVAGSAGTLANDGDPSEWDLDSQTIIGTSGGVKQLIFYAAVNGDSNDSGLTNATL
TAAYNKAVTDNVAKVINVSLGEDEAAANSDGSLAANDAVFKQAVAQGQIFSVSSGDAGVY
QWSTSPYGSPGYVGTYSGGKVTTKINLAKYSVSSPASSPYVVAVGGTTLSTSGTTTWAGE
TVWNEGLAYADVSSSGQPLDNAVRLWATGGGVSGYEAAPSWQTAALGSSVTKRVVPDVAF
DAAQATGAYLVING
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaactcagcatgtcaaccggctattctcgaaacgcttcgcgctgtcgctgcta
ccgctggcgattgccgccacgttgtccccgctcgtcgcgcacgcggcccccgactgggcg
ccgacccgcaccgacgccttcctgatcgcgcgcgcgagcgccgcggccgcatcgcaaacg
ctcgcgaagaccgcgccgagctacgcgctcaacgtgatcggcacgcccgagctcaccgat
acgaacgtcacgccgctcgagctgagccagccgctgcacgtgaccatcgtgctgaagagc
cgcaacgaagcgcagctcgacgcgctcgtgcgcgaagtgaaccagcccggcagcgcgaac
tatcgcaagtacctgacgcccgagcagttcaacgcgcgcttcgcgccgaccgacgatcag
gtgcgggccgtcgtcgcgcacctgaaggcgaacggcttcggcaacatcacggtatcggcg
aacaacaagctgatcttcgcgcaaggcaacgcgtcgaacgcggagcgcggcttccatacg
acgctcaagcgcttcaactaccgcggcaaggcggtctatgcgaacgactcggccgcgctg
gttcccgcatcgctgagcccgttcgtcgaatcggtgctcgggctgcagagcgcggccgtt
ccgcatcggctgatccatcgcggcacgccggccgacgcgcgcatccagaccgacacgatc
acgaagaacgcgacggcgagcggctcgcaggtcggccatcagccgaccgatttcgcgcag
atctacgacgcgagcggcctgcccgccgcgaccagcacgacggtcgggatcatcacgtgg
ggcgacatgacgcagacgatcgccgacctgaacacgttcacgcagaacgcgggcctgccg
accgtcaacaccgccgtcgtcgcgggcagcgcgggcacgctcgcgaacgacggcgatccg
agcgaatgggatctcgacagccagacgatcatcggcacctcgggcggcgtgaagcaactg
atcttctatgcggccgtcaacggcgacagcaacgacagcggcctcacgaatgcgacgctg
accgccgcatacaacaaggccgtcaccgacaacgtcgcgaaagtcatcaacgtatcgctc
ggcgaggacgaagcagccgcgaattcggacggctcgctcgccgcgaacgacgcggtgttc
aagcaggcggtcgctcaagggcagatcttctcggtgtcgtccggcgacgcgggcgtctat
caatggtcgacttcgccgtacggctcgcccggctacgtcggcacctacagcggcggcaag
gtgacgacgaagatcaatctggcgaagtacagcgtgtcgtcgccggcgagctcgccgtac
gtcgtcgcggtcggcggcacgaccctgtcgacgagcggcacgacgacctgggcgggcgag
accgtctggaacgaagggctcgcctacgcggacgtcagcagcagcggccagccgctcgac
aatgcggtgcggctgtgggcgacgggcggcggcgtcagcggctacgaagcggcgccgagc
tggcagacggccgcgctcggcagctcggtgacgaagcgcgtcgtgccggacgtcgcgttc
gacgccgcgcaggcgacgggcgcgtatctcgtgatcaacggctag

DBGET integrated database retrieval system