KEGG   Burkholderia sp. RPE67: BRPE67_ACDS06000Help
Entry
BRPE67_ACDS06000  CDS       T03604                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00860  Porphyrin and chlorophyll metabolism
bue01100  Metabolic pathways
Module
bue_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRPE67_ACDS06000 (cobQ)
Enzymes [BR:bue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BRPE67_ACDS06000 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 BPL_N GATase
Motif
Other DBs
NCBI-ProteinID: BAO85655
UniProt: A0A060NWD5
Position
1:653210..654685
Genome map
AA seq 491 aa AA seqDB search
MPFTPRGSLMIQGTTSDAGKSTLVAGLARLARRGGVRVAPFKPQNMALNSAVTVDGGEIG
RAQALQAVAAGVEARIDFNPVLLKPTSDRGAQVIIHGHAHANLDARAYHDYKRIAFDAVL
TSYERLRGEFDVVIVEGAGSPAEINLRDGDIANMGFAERVDCPVVLVADIDRGGVFAHLV
GTLACLSESERARVRGFVINRFRGDIGLLQPGLDWLEAQTGKPVFGVLPYLHGLTLDAED
MLPSQPHARGADSVLKVIVPALPRISNHTDFDALRAHPQVDFSYVRAGIAPPAADLIVLP
GSKSVQRDLAWLRDNGWDRAIERHLRYGGKVLGICGGMQMLGREIDDPAGVEGAAGRVRG
LALLELFTELTAHKQLENVSGQLMLGDTRAPVRGYEIHMGRTHGAALSRPFVALDAGRVD
GALSDDGQIAATYLHGVFDTPEACAALLAWAGVNDAAPLDYPALREASLDRLADSFAEAL
DLGALQAAFAQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgccattcacgccacgcggctcgctgatgattcagggcacgacgtccgatgccggcaag
agcacgctcgtcgcgggcctggcgcgtctcgcgcggcgcggcggcgtgcgcgtcgcgcca
ttcaagccgcagaacatggcgctcaacagcgcagtgaccgtcgatggcggcgagatcggc
cgcgcgcaggcgctgcaggcggtcgcggcgggcgtcgaggcgcgcatcgacttcaatccg
gtgctgctcaagccgacgagcgatcgcggcgcgcaggtcatcatccacggtcacgcgcac
gcgaatctcgatgcgcgtgcgtatcacgactacaagcgcatcgccttcgatgccgtgctc
acgtcctacgagcgcttgcgcggcgagttcgatgtggtgatcgtcgaaggcgcgggcagt
cccgccgagattaatttgcgcgacggcgatatcgccaacatgggcttcgccgagcgcgtc
gattgcccggtcgtgctcgtcgcggatatcgaccgcggcggcgtgttcgcgcatctcgtc
ggcacgctcgcgtgtttgtcggagagcgagcgcgcgcgcgtgcgcgggtttgttatcaac
cggtttcgcggggatatcggcctgttgcagccggggctcgactggctggaagcgcagacg
ggcaaaccggtgttcggcgtgctgccgtatctgcacggcctcacgctcgatgccgaagac
atgctgccgagccagccgcatgcgcgcggggccgatagcgtgctgaaagtgatcgtgccg
gcgctgccgcgcatcagcaatcacaccgatttcgatgctttgcgggcgcatccgcaggtc
gatttctcgtatgtccgcgcgggcatcgcgccgcctgctgccgatctcatcgtcctgccc
ggctcgaaaagcgtgcagcgcgatttagcgtggctgcgcgacaacggctgggatcgcgcg
atcgagcggcatctgcgctacggcggcaaggtgctcggcatttgcggcggcatgcagatg
ctagggcgcgagatcgacgatccggcgggcgtcgaaggcgcggcggggcgcgttcgggga
ttggcgctgctcgaactgttcaccgagctcacggcgcacaagcaactggagaacgtcagc
gggcaattgatgctcggcgacacgcgagcgcccgtgcgcggctacgagatccatatgggc
cgcacgcacggcgcggcgctttcgcggcctttcgttgcgctggatgcggggcgtgtggac
ggcgcgttgtcggacgacggccagattgccgcgacgtatctgcacggtgttttcgataca
cccgaagcctgcgcggcgctgctcgcgtgggcgggcgtgaacgacgccgcgccgctcgat
tacccggcgctgcgcgaagcgtcgctggacaggctggccgattcgtttgcggaagcgctg
gatctgggcgcgttgcaggccgccttcgctcaataa

DBGET integrated database retrieval system