KEGG   Burkholderia sp. RPE67: BRPE67_ACDS15750Help
Entry
BRPE67_ACDS15750  CDS       T03604                                 

Gene name
rluA
Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bue  Burkholderia sp. RPE67
Brite
KEGG Orthology (KO) [BR:bue00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bue03009]
    BRPE67_ACDS15750 (rluA)
Enzymes [BR:bue01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BRPE67_ACDS15750 (rluA)
Ribosome biogenesis [BR:bue03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BRPE67_ACDS15750 (rluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: BAO86630
UniProt: A0A060NZ46
Position
1:complement(1694335..1695495)
Genome map
AA seq 386 aa AA seqDB search
MTRSSTRRTKDQLKDYSRSATGDDSASADSAAGADREAPREARVPDALAGERLDKVLARI
FPEFSRNRMQGWIEEGRVLVDGALAKVRQPVPLGAMITLVPDLLPEQLAFAPEAVPLHIV
YEDETLVVINKPAGMVVHPAAGNWSGTLLNGLLHRYGEAAAGLPRAGIVHRLDKETSGLM
VVARTLQAQTDLVRQLQARTVKRRYVAFVWGNMRDEGTIDAPIGRDPRERTRMAVVQSAS
GKPARTHFKTIDRTTWHGQPVSAIHCDLETGRTHQIRVHCAHAGHPLLGDPVYGRARGKR
SVTPLPNGFARQALHAWRLGLIHPATGKDVHWRADVPEDIAALAAELGFGQDEEVEFDEE
GDFAQAYEMGEGEDDWDDEDYEDDEA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctcaagtactcgtcgtaccaaagaccaactcaaagattatagccgaagcgcc
accggcgacgactcggcatccgccgattccgcagccggcgcggaccgcgaagcgccgcgc
gaggcgcgcgtgcccgacgcgctcgcgggcgagcggctcgacaaggtgctcgccaggatc
ttccccgagttctcgcgcaaccgcatgcagggctggatcgaggaagggcgcgtgctcgtc
gacggcgcgctcgcgaaggtgcgccagcccgtgccgcttggcgccatgatcacgctcgtg
ccggacctgctgcccgagcagctcgcgttcgcgccggaagccgtgccgctgcatatcgtg
tatgaggacgagacgctcgtcgtcatcaacaagcccgcgggcatggtcgtgcatccggcg
gcgggcaactggagcggcacgctgctcaacggtctcttgcatcgttacggcgaggcggcc
gcggggctgccgcgcgccggcatcgtgcatcggctggacaaggaaacctccgggctcatg
gtcgtcgcgcgcacgctgcaggcgcagaccgacctcgtgcgtcagttgcaggcgcgcacg
gtgaaacgccgctacgtcgcgttcgtgtggggcaatatgcgcgacgaaggcacgatcgac
gcgcccatcggccgcgatccgcgcgagcgcacgcgcatggcggtggtgcagagcgcatcg
ggcaaaccggcgcgcacgcacttcaagacgatcgaccgcacgacgtggcacggccagccg
gtgagcgccattcattgcgatctcgaaaccggccgcacgcatcagattcgcgtgcattgc
gcgcacgcggggcatccgctgctcggcgatcccgtgtacggacgcgcgcgcggcaagcgt
tcggtgacgccgttgccgaacggtttcgcgcgtcaggccctgcacgcgtggcggctcggc
ttgatccatcccgcgaccggcaaggacgtgcactggcgcgcagacgtgccggaagacatc
gcggcgctcgccgcggaactcggcttcgggcaggatgaggaagtcgaattcgacgaggag
ggcgacttcgcgcaagcctacgaaatgggcgagggcgaagacgactgggacgacgaagac
tacgaggacgacgaagcatga

DBGET integrated database retrieval system