KEGG   Burkholderia sp. RPE67: BRPE67_ACDS18890Help
Entry
BRPE67_ACDS18890  CDS       T03604                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00260  Glycine, serine and threonine metabolism
bue01100  Metabolic pathways
bue01110  Biosynthesis of secondary metabolites
bue01120  Microbial metabolism in diverse environments
bue01130  Biosynthesis of antibiotics
bue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRPE67_ACDS18890
Enzymes [BR:bue01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BRPE67_ACDS18890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: BAO86944
UniProt: A0A060P752
Position
1:complement(2043344..2044399)
Genome map
AA seq 351 aa AA seqDB search
MTAPTDPTQHFASDNYAGICPEALAALIQANTSGHEPAYGDDSWTAQVCDRIRDLFQTDC
EVFFVFNGTAANSLALASLCQSYHSVICHELAHIETDECGGPEFFSGGSKLLTAKGENGK
LTPDAIEELITKRADIHYPKPKVVALTQATEVGTVYTVEEIRAIAAIAKRRHLKVHMDGA
RFANAVATLGVHPSEITWRAGVDVLCFGGTKNGLPVGEAVVFFDRALAADFAYRLKQAGQ
LASKMRFISAPWLGLLDDDVWLRNARRANAMAQLMAERLVAIPGVSLLFKPEANAVFAEL
PAHVAAALRAKGWRFYQFIGSGGCRLMCAWDTQRETVERFADDVRALAAAR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccacggacccgacccagcatttcgcctccgacaactacgcaggcatctgc
cccgaagcgctagcggcgctgatccaggcgaatacgagcggccacgagcccgcctacggc
gacgattcgtggacggcgcaagtctgcgaccgcatccgcgatctctttcagaccgactgc
gaagtcttcttcgtgttcaacggcacggcggcgaattcgctcgcgctcgcctcgctgtgc
cagtcgtatcactcggtcatctgccacgagctcgcgcatatcgaaaccgatgaatgcggc
ggccccgagttcttctccggcggctcgaagctgctcacggcgaagggcgagaacggcaag
ctcacgccggatgccatcgaggaactcatcaccaagcgcgcggacatccactatccgaag
ccgaaggtcgtcgcgctcacgcaggcgaccgaagtcggcaccgtctacaccgtcgaggag
attcgcgcgatcgcggcgattgcgaagcgccggcatctgaaagtgcacatggacggcgcg
cgctttgcgaacgcggtcgcgacgctcggcgtgcatccgtcggagatcacgtggcgcgcc
ggcgtggacgtgctgtgcttcggcggcacgaaaaacggcttgccggtcggcgaggcggtc
gtgtttttcgaccgtgcgctcgccgccgactttgcctatcggctgaagcaggcgggacag
ctcgcctcgaagatgcgctttatctccgcgccgtggctgggtcttctcgatgacgacgtc
tggctgcgcaacgcgcgtcgcgccaacgcgatggcgcaactgatggccgagcggctcgtc
gccattcccggcgtcagcctgctgttcaagcctgaagcgaatgccgtgttcgccgaactg
ccggcgcacgtcgccgcggcgctgcgcgcgaagggctggcgcttctatcaattcatcggc
tcgggcggctgccgtctgatgtgcgcatgggacacgcaacgcgagaccgtcgagcgcttc
gccgacgacgtgcgcgcgttggccgccgcgcgttga

DBGET integrated database retrieval system