KEGG   Burkholderia sp. RPE67: BRPE67_BCDS15120Help
Entry
BRPE67_BCDS15120  CDS       T03604                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bue  Burkholderia sp. RPE67
Brite
KEGG Orthology (KO) [BR:bue00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BRPE67_BCDS15120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAO89426
UniProt: A0A060P3H9
Position
2:1578609..1580192
Genome map
AA seq 527 aa AA seqDB search
MNQVVFPQSQGRSPGQRYALLVFLLVIAAGAVYCVTHLLDDLAPVRESSAFPYILLGIAL
LIALGFEFVNGFHDTANAVATVIYTHSLTPNLAVVWSGAWNFIGVLISSGAVAFGILQLL
PVELIIGVGSSQGFAMVFALLIAAIIWNLGTWALGLPSSSSHTLIGSVIGVGLMNQMLHG
TNGTSGVDWSQAVSVGKSLLFSPLVGFIAAAFLLYVLKLVVRVPALYKEPEKNTPPPFWI
RCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPGETQTFLAVSHSA
SEVLQRYSNGAQPAPDARAQVEKYVQTKTLAPDTVASLKSLVDSIDTEIRPHDTISAVPQ
GTVKNVRNEMYIASEALRIMEKQKAPAFSADDGAVIDNYKKQLDHATKFIPTWVKVAVAV
ALGLGTMVGWKRIVVTVGERIGKTHLTYGQGASAELVAMLTIGAADAYGLPVSTTHVLSS
GVAGTMAANGSGLQWRTVRSLALAWILTLPVSIALAGLLFWVFRSIF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagttgtctttccccaatctcaaggccgctcgcccggacagcgctatgcgctg
ctggtgtttctgctcgtcatcgcggcgggcgcggtgtactgcgtcacgcatttgctcgac
gacctcgcgcccgtgcgcgagtcgtcggcgtttccgtacatcctgctcggcatcgcgctc
ctgatcgcgctcggcttcgaattcgtcaacggatttcacgacacggccaacgccgtcgca
accgtaatttacacgcactctttgacacccaatctcgcggtcgtctggtcgggcgcatgg
aacttcatcggcgtgctgatttcgagcggcgcggtcgcgttcggcatcctgcaactgctg
ccggtggaactgattatcggcgtcggcagttcgcagggcttcgcgatggtcttcgcgctg
ctgatcgcggcgatcatctggaatctgggcacgtgggcgctcggccttccttcttcgagt
tcgcatacgctgatcggttcggtgatcggcgtcggcctcatgaaccagatgctgcacggc
acgaacggcacgtcgggcgtcgactggagccaggcggtgtcggtcggcaagtcgttgctg
ttttcgccgctcgtcggctttatcgccgcggcgttcctgctgtatgtgctgaagctcgtc
gtgcgcgtgccggcgctctacaaggaacccgagaagaacacgccgccgccgttctggatt
cgctgcctgctgatcctcacgtgcacgggcgtgtccttcgcgcacggctccaacgatggc
cagaagggcatgggcctcatcatgctgattctgatcggcacggtgccgaccgcctacgcg
ctcaacaaggccgtgacaccgggcgaaacgcagactttcctcgccgtaagccacagcgcc
tccgaggtgctccagcgctacagcaacggcgcgcagcccgcgcccgatgcgcgcgcgcaa
gtcgagaaatacgtgcagacgaagacgctcgcgccggacacggtcgcctcgctgaagagt
ctcgtcgattcgatcgatacggagattcgcccgcacgacacgatttccgccgtgccgcag
ggcacggtgaagaacgtgcgcaacgagatgtacatcgcgtcggaagcgctgcgcatcatg
gaaaagcagaaagcgcccgcgttttcggcggatgacggcgcggtcatcgacaactacaag
aagcagctcgatcacgcgaccaagttcattccgacgtgggtgaaagtggccgtcgcggtt
gcgctcggcctcggcacgatggtcggctggaagcgtatcgtcgtgacggtcggcgagcgc
atcggcaagacgcatctcacgtatggacaaggcgcgtcggcggaactcgtcgcgatgctg
accatcggcgcggccgatgcctacggcctgccggtctcgacgacgcatgtgctgtcgtcg
ggcgtcgcgggcacgatggccgcgaacggctccggcctgcaatggcgcacggtgcgcagc
ctcgcgctcgcctggattctgacgctgccggtgtcgatcgcgctggccggtctgctgttc
tgggtgttccgcagcatcttctga

DBGET integrated database retrieval system