KEGG   Burkholderia sp. RPE67: BRPE67_DCDS08690Help
Entry
BRPE67_DCDS08690  CDS       T03604                                 

Definition
(GenBank) nucleoside-diphosphate-sugar epimerase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00053  Ascorbate and aldarate metabolism
bue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BRPE67_DCDS08690
Enzymes [BR:bue01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     BRPE67_DCDS08690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind NAD_binding_10 adh_short Polysacc_synt_2 adh_short_C2 WH1
Motif
Other DBs
NCBI-ProteinID: BAO92024
Position
p1:complement(927238..928083)
Genome map
AA seq 281 aa AA seqDB search
MEQQQGTPSANAAVQFDRLLLTGAAGGIGRAIRHRVAEFARQVRISDLPGVLPGDAAPHE
EIVPCDLADRQAVDALASHCDAIVHLGGVSVERPFEEILEANIKGVFNLYEAARRQGVKR
IVFASSNHVTGFYRQDERIDATARKRPDGYYGLSKSFGEDTAQLYFDRYGIETVSIRIGS
VFPEPKDRRMMASWMSYNDFHDLLRRSLFTPDVGHTIVFGMSANAHTWWDNRCAAHLGFV
PRDSSEPFREKVEAAPPPAPTDPVAVLQGGAFTVTGPFDPV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaacaaggcacgccctccgcgaacgccgccgtgcaattcgaccgtttgctg
ctgacgggcgccgcgggcggcatcgggcgggcgatccggcatcgtgtcgcggagttcgcg
cggcaggtgcgtatctccgatctgcccggcgtgctgccgggcgatgcggcgcctcatgaa
gaaatcgtgccgtgcgatctggccgaccgccaggccgtcgatgcgctcgccagccattgc
gatgcgatcgttcatctcggcggcgtgtcggtggagcgccccttcgaagagattctcgaa
gccaatatcaagggcgtgttcaacctctacgaagcggcgcgccgtcagggcgtgaagcgc
atcgtgttcgcgagctcgaatcacgtcacgggtttctatcggcaggacgaacgaatcgac
gccaccgcgcgcaagcgtcccgatggctattacggcttgtccaagtccttcggcgaggac
acggcgcagctctatttcgaccgctacggcatcgaaacggtgagcatccgcatcggctcg
gtgtttccggagccgaaggaccgccgcatgatggcgagctggatgagctacaacgacttc
cacgatctgttgcgccgcagcctcttcacgccggacgtcgggcacacgatcgtcttcggc
atgtccgcgaacgcgcatacgtggtgggacaaccgctgcgccgcgcatctgggtttcgtg
ccgcgcgactcgtccgagccattccgcgaaaaggtcgaggcggcgccgccgcccgcgccg
accgatccggtggccgtgctgcaaggcggcgcgttcaccgtgaccggcccgttcgatccg
gtttaa

DBGET integrated database retrieval system