KEGG   Burkholderia sp. RPE67: BRPE67_DCDS13380Help
Entry
BRPE67_DCDS13380  CDS       T03604                                 

Definition
(GenBank) acetyl-coA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00071  Fatty acid degradation
bue00072  Synthesis and degradation of ketone bodies
bue00280  Valine, leucine and isoleucine degradation
bue00310  Lysine degradation
bue00362  Benzoate degradation
bue00380  Tryptophan metabolism
bue00620  Pyruvate metabolism
bue00630  Glyoxylate and dicarboxylate metabolism
bue00640  Propanoate metabolism
bue00650  Butanoate metabolism
bue00900  Terpenoid backbone biosynthesis
bue01100  Metabolic pathways
bue01110  Biosynthesis of secondary metabolites
bue01120  Microbial metabolism in diverse environments
bue01130  Biosynthesis of antibiotics
bue01200  Carbon metabolism
bue01212  Fatty acid metabolism
bue02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRPE67_DCDS13380
   00630 Glyoxylate and dicarboxylate metabolism
    BRPE67_DCDS13380
   00640 Propanoate metabolism
    BRPE67_DCDS13380
   00650 Butanoate metabolism
    BRPE67_DCDS13380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRPE67_DCDS13380
   00072 Synthesis and degradation of ketone bodies
    BRPE67_DCDS13380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRPE67_DCDS13380
   00310 Lysine degradation
    BRPE67_DCDS13380
   00380 Tryptophan metabolism
    BRPE67_DCDS13380
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRPE67_DCDS13380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRPE67_DCDS13380
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRPE67_DCDS13380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bue04147]
    BRPE67_DCDS13380
Enzymes [BR:bue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRPE67_DCDS13380
Exosome [BR:bue04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRPE67_DCDS13380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAO92493
UniProt: A0A060PLC3
Position
p1:complement(1428678..1429859)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPDLGATIIKAALERAGVKPDQVSEVIMGQVLAAG
SGQNPARQSLIKAGLPDMVPGMTINKVCGSGLKAVMLAANAIIAGDADIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLIDTMIVDGLWDVYNNYHMGTTAENVAKEFGITREQQDAFAA
LSQNKAEAAQKAGRFNDEIVPVAIPQRKGDPIQFATDEFVRHGVTAEALAGLKPAFSKEG
TVTAANASGINDGAAAVVVMSAKKAEALGLTPLARIKAYANAGVSPKIMGMGPVPASKRC
LERAGWSVNDLDLMEINEAFAAQALAVHKQMGWDQERINVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKKGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgtacggcggtaggcaaattcggcggttcg
ctcgcgaagatcgcggcgccggacctgggtgcgacgattatcaaggccgcgctggagcgc
gcgggcgtgaagccggatcaggtgagcgaagtcatcatgggccaggtgctggcggcgggc
tcgggccagaacccggcgcgccagtcgctgatcaaggcgggcttgcccgacatggtgccc
ggcatgacgatcaacaaggtctgcggctcgggcctgaaggcggtgatgctcgccgcgaac
gcgatcatcgcgggcgatgcggatatcgtcgtcgcgggcggtcaggaaaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggtttccgcatgggcgacgccaaactcatc
gacacgatgatcgtcgacggcctgtgggacgtctataacaactatcacatgggcacgacg
gcggaaaacgtcgcgaaggaattcggcatcacgcgcgagcagcaggacgcgttcgcggcg
ctgtcgcagaacaaggccgaggccgcgcaaaaggcgggccgcttcaacgacgaaatcgtg
ccggtcgcgattccgcagcgcaagggcgacccgatccagttcgctaccgacgaattcgtg
cgtcacggcgtgacggccgaagcgctcgcgggcctgaagccggcgttctcgaaggaaggc
acggtgacggcggcgaacgcatcgggcatcaacgacggcgcggcggcggtcgtggtgatg
tcggcgaagaaggccgaggcgctcggtctgacgccgctcgcacgcatcaaggcgtacgcg
aacgcgggtgtgtcgccgaagatcatgggcatgggcccggtgccggcgtcgaagcgctgt
ctggagcgcgcgggctggagcgtgaacgatctcgatctgatggaaatcaacgaggcgttc
gcggcgcaggcgctcgcggtgcacaagcagatgggctgggatcaggaaaggatcaacgtg
aacggcggcgcgatcgcgatcggccatccgatcggtgcatcgggctgccggattctcgtc
acgctgctgcacgaaatgcagaagcgcgacgcgaagaagggcctggcgtcgctgtgcatc
ggcggcggcatgggtgtcgcgctggcactcgagcgtccgtaa

DBGET integrated database retrieval system