KEGG   Buttiauxella sp. 3AFRM03: D8682_11435Help
Entry
D8682_11435       CDS       T05676                                 

Gene name
ampD
Definition
(GenBank) 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD
  KO
K03806  N-acetyl-anhydromuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
buf  Buttiauxella sp. 3AFRM03
Brite
KEGG Orthology (KO) [BR:buf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buf01011]
    D8682_11435 (ampD)
Enzymes [BR:buf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     D8682_11435 (ampD)
Peptidoglycan biosynthesis and degradation proteins [BR:buf01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   D8682_11435 (ampD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2
Motif
Other DBs
NCBI-ProteinID: AYN27537
UniProt: A0A3G2IFD5
Position
complement(2135401..2135964)
Genome map
AA seq 187 aa AA seqDB search
MQLKDGWLVGVKQVPSPHFDCRPEDETPSLLVVHNISLPPGEFGGPWIDALFSGTLDATA
HPYFAGIAHLRVSAHCLIRRDGKIVQYVPFDKRAWHAGISLYQGRERCNDFSIGIELEGT
DTLPYTDAQYQQLTAITETLIQAYPSIADNMTGHCDIAPDRKTDPGPAFDWSRFRQAVEV
TSNKENK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcagctaaaagacggctggctagtgggcgtaaagcaggttccttccccacatttcgat
tgccgaccggaggatgaaaccccttcgctgctggtggtgcataacatcagtttgccacca
ggagaatttggtggtccatggattgatgctttgtttagtggcacgcttgacgccacggct
cacccatattttgccggaatcgcccatttgcgcgtttcggcgcattgtttgattcgccgt
gatggcaaaatcgttcagtatgttccttttgataaacgtgcctggcatgcgggtatttct
ttgtatcaggggcgtgagcgctgtaacgatttttccattggtatagagctggagggtacc
gatacgctgccttatactgatgcgcaatatcaacagcttacggctatcactgaaacattg
attcaggcgtatccgtcaattgctgacaatatgacggggcattgcgatattgcaccggat
cgtaagacagacccaggccccgcgtttgattggtcgcgttttcgtcaggcggttgaggtc
acgtcaaacaaggagaacaaatga

DBGET integrated database retrieval system