KEGG   Buttiauxella sp. 3AFRM03: D8682_14165Help
Entry
D8682_14165       CDS       T05676                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
buf  Buttiauxella sp. 3AFRM03
Pathway
buf00620  Pyruvate metabolism
buf00630  Glyoxylate and dicarboxylate metabolism
buf01100  Metabolic pathways
buf01110  Biosynthesis of secondary metabolites
buf01120  Microbial metabolism in diverse environments
buf01200  Carbon metabolism
Module
buf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:buf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D8682_14165
   00630 Glyoxylate and dicarboxylate metabolism
    D8682_14165
Enzymes [BR:buf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     D8682_14165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AYN28029
UniProt: A0A3G2IFF3
Position
complement(2721565..2723163)
Genome map
AA seq 532 aa AA seqDB search
MTQQTVSAELAFSQPFGEPERQILTPDAVEFLSELVTRFTPQRNKLLAARTVQQAEIDAG
KLPDFISETSSIRESEWTIRGIPADLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWSKVIDGQINLRDAIRGTISWTNEAGKIYQLKPDPAVLVCRVRGLHLPEKHVTWRD
EPIPGSLFDFALYFFHNVDALQAKGSGPYFYLPKTQSWQEAAWWSEVFSFTEDHFSLPRG
TIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMDKPFLNAYSRLLIKTCHRRGAFAMGGMAAFIPSKDSQRNDWVLNKVKADKQMEATNGH
DGTWIAHPGLADTVMEVFSKALGDDKNQLPVLREEDAPITAAQLLEPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGETVTKALFSQ
MLAEEMFVIQEELGDKRFSQGRFDEAARLMEQITTSDTLIDFLTLPGYRLLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagacagttagcgcagagttggcctttagccagccgtttggtgaaccagag
cgacagattctgacgcctgatgcagtagagtttctcagtgagctcgtcacccgctttaca
ccgcagcgtaataagctactggcggcacgcaccgttcagcaggctgaaattgacgcaggg
aaacttccagattttatttcggaaaccagttccattcgtgaatcagaatggactattcgc
ggtattccggccgatttactcgaccgccgcgttgagatcaccgggcctgtcgaacgcaaa
atggtgattaacgcgctgaatgctaacgtcaaagtttttatggctgactttgaagactcc
ctcgctcccagctggagcaaagtgatcgacggccaaatcaacctgcgcgacgccattcgc
gggacgatcagctggactaacgaagccggtaaaatctaccagttgaagcctgatccagcc
gtattagtctgccgtgttcgtggcctgcacttaccagaaaaacatgtcacctggcgtgat
gagcctattccaggcagcttgttcgacttcgcactctacttcttccataacgtggacgcc
ttgcaggcaaaaggtagcggcccgtatttctacctgccaaaaacgcaatcctggcaagaa
gcggcctggtggagtgaagtcttcagttttactgaagatcatttctctctgccgcgtggc
accattaaagcgacgttgctgattgaaacgctccctgcggtattccagatggacgagatc
ctgcatgcgctgcgagatcacattgtggggctgaattgtggccgctgggattacattttc
agctacatcaagacactaaagaatcatccggatcgcgtccttccggacaggcagtccgtc
accatggacaaacccttcctgaatgcttattcgcgcttgctgattaaaacctgtcatcgc
cgtggtgctttcgccatgggcggcatggcggcgttcattccgagtaaagacagccaacgt
aacgactgggtgcttaacaaagttaaagccgacaaacaaatggaagcgaccaatggccat
gacggcacatggattgcgcatccgggccttgctgacacagtgatggaggtctttagcaaa
gcgttgggcgacgataaaaaccagcttcctgttttgcgtgaagaagacgcaccgattact
gccgcacaactgcttgaaccttgtcctggtgagcgcacagaagcgggtatgcgagccaat
attcgcgtggcggtgcagtacatcgaagcatggatttctggcaatggttgcgtaccgatt
tacggcttgatggaagatgctgcgaccgcagagatttcccgtacttctatctggcagtgg
attcatcatgaaaaaacgttgagtaacggtgagacagtcactaaggcgctgttcagccaa
atgctggctgaagaaatgttcgttattcaggaagaattaggtgacaagcgtttcagccag
gggcgtttcgatgaagccgctcgcctgatggagcaaatcaccacttccgatacgttaatc
gacttcctgacgctgccaggctaccgcctgcttgcctga

DBGET integrated database retrieval system